SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|263242|SNAP_00031300 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|263242|SNAP_00031300
Domain Number 1 Region: 55-115
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000418
Family Tachycitin 0.024
Further Details:      
 
Domain Number 2 Region: 119-189
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000194
Family Tachycitin 0.029
Further Details:      
 
Domain Number 3 Region: 207-252
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000366
Family Tachycitin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|263242|SNAP_00031300
Sequence length 337
Sequence
MLIFALQTAKKVLQRSSLTININHSSVASSAVNMWIPTLFAVTAFVGCIAGAALPTPRCE
LSLRPYMMEDDEFCDKYYVCLNGTATEEFCDDGLVFDTTKDKCELPHAVQCGDRKKQQNP
RPTSNCPRRNGMFPVKGSCDKFYHCTDGQHTLIACPPGVIFEPLVGACVHADQTNRPNCS
ASQVLNFVCPHIGSGANPSASLRFGDHDRLAHPTSCRHFYMCLLTGMPRLGGCTYGLVFN
PVSGRCDQPQNWYGEDDPIEEDGIPDATVAPALSSRRINNSAVRTAAPAVSVARVEPGEV
AKLKAHQPMRRLSTGTNRFGLVQEDPIDSDKSDLDEE
Download sequence
Identical sequences E9HPE8
jgi|Dappu1|263242|SNAP_00031300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]