SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|303213|PASA_GEN_0200343 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|303213|PASA_GEN_0200343
Domain Number 1 Region: 1619-1764
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.45e-38
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 1444-1603
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.63e-26
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 216-276
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000068
Family BSTI 0.034
Further Details:      
 
Domain Number 4 Region: 937-1001
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000207
Family Tachycitin 0.015
Further Details:      
 
Domain Number 5 Region: 2673-2734
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000834
Family ATI-like 0.047
Further Details:      
 
Domain Number 6 Region: 2338-2400
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000837
Family ATI-like 0.017
Further Details:      
 
Domain Number 7 Region: 3224-3295
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000983
Family VWC domain 0.008
Further Details:      
 
Domain Number 8 Region: 370-426
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000589
Family ATI-like 0.045
Further Details:      
 
Domain Number 9 Region: 3152-3232
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000418
Family VWC domain 0.026
Further Details:      
 
Domain Number 10 Region: 419-465
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000795
Family Fibronectin type I module 0.055
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|303213|PASA_GEN_0200343
Domain Number - Region: 2962-3022
Classification Level Classification E-value
Superfamily FnI-like domain 0.00091
Family Fibronectin type I module 0.076
Further Details:      
 
Domain Number - Region: 2726-2798
Classification Level Classification E-value
Superfamily FnI-like domain 0.00126
Family VWC domain 0.018
Further Details:      
 
Domain Number - Region: 3024-3094
Classification Level Classification E-value
Superfamily FnI-like domain 0.00565
Family Fibronectin type I module 0.034
Further Details:      
 
Domain Number - Region: 3085-3159
Classification Level Classification E-value
Superfamily FnI-like domain 0.046
Family VWC domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|303213|PASA_GEN_0200343
Sequence length 3469
Sequence
MTSTVCQAEMGVAEEEEEEEEEEEEDFEIVVGRLHCHELSSQEPLYCPVVHENGDHQDRW
RRRHQVEAGSGASKWIGNLVGRPQQGLCGTFNENQRDDMTTPEGDVEQSVAAFANSWKTK
EVCQDASIDLEPIHPCELNGHKKAETERQCAKIKDTVFEPCHQVVDPEPYYRDCLYDVCS
CQVKLGECLCPTIAAYAKECSQKGVLVDWIPEVRECGVHCRGGQTYQVCANSCARTCYDI
ALYPKCRRKCVEGCNCPEGQTLDPFGLCIPIHECPCIHKGIEYQPGHKELRPGARSPDLW
YRTLFPPPVAIYNRYYFNSRNICQMFFSDCLCRRSTCISARWHCQPATLEERDLLANVTL
RTQMECRSSHNEEYTPCEPEHQLTCKTMGQQVSMKKPVECRPGCQCKKGYIFDPTSKTCI
KPSECPCHHAGQSYSENNRITQDCNTCTCHSGKWECTKNQCPGLCTNWGESHYKTFDGKQ
YDFHGNCDYMMAKGAATEPNEKFHVTVQSVPCGSSGVACSKSVTLRLGSTGAGEESITLT
RHKKIPLGKFSERILVREAGLFIFIEVADLGLVLQWDHGTRIYLRLDPKWKGRVRGLCGN
FNDNALDDFQPPSGGITEVDARACWILADAIWAVTASVCARRSPTLQCNEECSSYSPCMT
TCPTVTCDNPLGSSSLCAADACVEGCQPKECPKGQIHRSANELSCMPISDCASALCMVVD
GVMYAEGDVIERDACHACYCSKGKRVCQGQPCYVPSTTASPVTIRTTAVPVSNTTIPEMG
ISTCRTGWSEWINTHHPKEGGNRNDVEPIPNRLNPGLANAPVCHTDQMVDIECRASQSKI
SHKKTGDNVDCNLKTGLECTPGGIKGRSVCHDYEIRILCDCSEMETRKPVLVEPTTKATP
VTKTSTRSPVVASTKIASTPISIKVEPTTPVPILGRCDPARPNSPHPTSCHLFYQCVDRI
GGVEQVEKTCQPPTMYNPDTMVCDWPEAVIRIRPDCGFITPTTTKKPATTGPCVDGWTDW
FSVTSPSAGTGDFEIYEKIVLQHPMCPKSHIRDIECKYMSREAGSKKKSGQARSLADYRS
SPDKNVQCTVSDGLICYNSDQDSGLCQDYKVRFLCRCEEDVFVITSPDTPTTEEAVTTTE
PPTTEEEGECPEGYAWNTCAYSCNQLCLAYGAELKQRGYCRTSEGCAPGCIEEEEADVQT
SFRNRGCSRGNLWRDARTCVPARDCTCRTPLGKIIAPGAVEESDDVCEVCQCLDNEYVCD
NSRCAYSWSTPSIDTVKNLTVITTPKPRPVGPTKAPASCSGWSDWINEYQKPAWGDYESK
SVAQLNKIGFCLTGRIADIECRDAKTDQLWTESRNKDLVCSLEKGFTCMPARQGKGRPCQ
DYKIRYFCECSGGDEGLGSTTTTPATTTTPTTTTTLRPTTTIMIWSTTKARPRFVDYCPD
EHLMPLLSNPLTVLDSSFVATTSKSGIYGPSSARFVSSSRPKRFAVRVTKSDLAWVAGKR
DMFQHIQVDLGTPTFVYGFEISGSPANKEYVTSLFVLYSEDNQRFSYVPNRKGKPRLFRG
PLEHDGRKKNMFDAPIEARYIRLEPQTWKHAIALRFDLFACNITSESIQLVTTPKPLDDV
CNDQMGLENGVIDDQQITLSSVNASFNQLRLGSDSAWMPAINSRKEHVQFDFLEPRNLSG
IVTQGHADGHSWIESYAVRYSSDGETWFTVLNDDSTQRVFHANVDGNTPTTNMFDRLIHA
RYLKIVPWSWHEAISLRMDILGCYEPITATLPPTLPPTTTTPTTPLPKFCHPCPNIPDDH
LNVDHCACPLTQKWNGTGCVHASQCPCFDSHTKYSVGAIYQAHDSCSQCVCRLGGVSDCQ
KPTCPACESGMLSYLSDHPQCKCLCKPCDSGTRLCQSSNVCLNESLWCNGVEDCPDDERN
CVTTTPEPVECLLAVCAEGYIEKNTGLFSNDGCPIYNCAPPASRPTGAPCPEPSCPAGFI
LELQMADYDSQQTGQSHLDYDQLSQNGQQHMDYDQQSNGDLGQLSQSTDEQQSANQESCP
PYKCVPEHPKTTPTPVTLPPLVERDDRCSMTGRMFHTFDGTEYSYDVCHHVLMRDMLNDL
WSVSVHDHCPSTETGCSRLLRIDHNKEIIELLPGLKVGYKGFEYSILQAEQIASLSPDFS
IHRVGDSVLFRSEAYSFWIVWDIHSNVKIGVTSKLLEHIDGLCGYYNLKSYDDQRTPEGT
LAKSTKEFGDSWSIEDSECAPIKCPVSFQTAAWDKCSFLRQDPFSQCHGSDEAALDKAIF
RCVDIMCDCMGSLKDKLITEIDAADTCACQAMSVMAVECHDELPTVDLTGWRSKYDCAID
CGTDGSVYKECNKKKCERSCQNNKNPHPCPPMPDLCYPGCVCPDGLVRHSDGKCVKPSEC
RDCVCDAFGDPHYISFDRNNFTFGGNCTYVAARDKLSKLEAKIDHDFQVLVTNSECNEDG
KTSCTDAVTIMYQDHVINVRNFEQTHSVMASMDGVPVDNFPVHLPWVRIEKLPGEQVSVL
LMAIQVEVSYYMYSRGFKVRLPSQLYLNKTEGLCGNCNSEIDDDSMSNQAGLGWLVSKLL
REPPTGEENLCQIAPQPECTPLNPDQDPCLKLLDSDLFKMCNAVVDPLPYIAACQYDTCK
SSDPASAACPSFESYARECSRYQVCLNWRSSQLCPIECPSGMEHQQCGSGCQSICGQDKD
LTFTCPMSVNDGCYCPTGHAFNQELGRCVPQDHCEPCDTEGHYKGDHWKPDACTTCSCDD
DGHVQCVKRSCALEECPPEHERSIIQPGENECCPTVKCMKEENLVTKKPCPEVPVPMCGQ
YQVLRYQNIDGCPRQVCECIPFDECPPMDTPAANPLVGVSYHVNTTGCCYHLDRVCSLDE
CPPKPECPPFYEIEVKASWEELCCPEFSCVPPKDVCVYEHVYAQHQNLEILTTTTPQPKG
KPRKGVKGKRSIQFRQDSLVQQYGINATWKDGPCLECTCLTELNNPIPRTTCTATNCPEP
VDDDYAIKAEPVPDNCCPRHVRIACRQGSNTYKVGETWPSPSGDPCQTYICLEGSDGTII
KQLQIESCPTCPSGWEYQTGNSSVCCGTCQQVACVSADGTQHAVGTTWKADLCTKISCVM
RDNGLQMESLRENCDKPTDEDIYNYETITPPNQCCPLYKRKSCLYNGREYQVNETWSTND
QCVTMICSLQADGQVARQEVMLSCPPASDCLEGYEHEPPGPTECCGKCVQVACVLNGTLH
PIGSSWNPDPCTFYSCVGSRGHGHVTESQVLCSPIGDCPEKNRIKKLDECCPVCNATESQ
KNCLPEEVPLEKTVGYVVHDSVMHGKCVNVEPVHGLTECVGHCQSKTVHEPNSIDPTSHC
ECCQAEETKELKTTLTCSDGKTWVQVLRVPTSCTCSLGCNGSADQQTTVNNPVVQAENLL
LATQQEQNLESLTQLVENQLKQQRDDDQLQILQQQSKGRGDAIARKGRR
Download sequence
Identical sequences E9FTU1
jgi|Dappu1|303213|PASA_GEN_0200343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]