SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|303616|PASA_GEN_22000009 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|303616|PASA_GEN_22000009
Domain Number 1 Region: 173-223
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000575
Family Tachycitin 0.022
Further Details:      
 
Domain Number 2 Region: 19-84
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000034
Family Tachycitin 0.033
Further Details:      
 
Domain Number 3 Region: 91-146
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000102
Family Tachycitin 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|303616|PASA_GEN_22000009
Sequence length 247
Sequence
MYTTALLLIAFVPLLTSAQAFVCPPKNGQYPDPIQCDKYYICQDGVASARLCEDGLVFDS
FKRSSHKCDHMHNVDCEDRTELQPPQGNAECPRRNGIFENADPSQCHKFVDCIDGQPKHN
VCPPGLHFNDASGVCTWEAAAGRTGCVREEFLEDGFTCPKLTAAESLTEPHPRYPHPTDC
QKFYVCLNGVTPREQNCDLGEVFNTNSKQCDLPENVAECIDWYKDHPSFVPGSVTPKSST
RGNSGQK
Download sequence
Identical sequences E9HRW1
jgi|Dappu1|303616|PASA_GEN_22000009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]