SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|304901|PASA_GEN_3100002 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|304901|PASA_GEN_3100002
Domain Number 1 Region: 21-273,344-402
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.2e-94
Family Type II chitinase 0.00000191
Further Details:      
 
Domain Number 2 Region: 395-455
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 7.85e-18
Family Tachycitin 0.0094
Further Details:      
 
Domain Number 3 Region: 265-335
Classification Level Classification E-value
Superfamily Chitinase insertion domain 4.73e-17
Family Chitinase insertion domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|304901|PASA_GEN_3100002
Sequence length 456
Sequence
MKIAAILAFSMLVVLANAQGNYKKVCYFANWARYRNGSGSYWVDKLDPYECTHYIYGFAV
LSNVTYEMTVYDPWADIDLGGYATFTGLKTKNPSLKTLIALGGWNDSAFSTQYSELVSDP
VKMANFVAKALAFVRQYNFDGLDFDWEYPGDPGKPEDKDNFTTLLRMLRDAFQPYNLILS
MAPSCSSARAAVSYDIPALGEIVDFVNFMAYDVHGAWENLTDHHAPLYRRDFDDDSSDVI
VSESVDYWLDQGFPPQKLVFGLPSYARSWTLADPNQHGLLAPAVGAGVAGQFTGLKGFYS
FYEICLFQQQGMTVVEDPTGKMGPYGYLGDIWASWDSIDMVVAKVKYMMSKGLGGVQFWE
LSLDDFNGHCNLGLRPFSKAITETLGGTFPTPGPTPPPPASCSASSQGQYYADPSDCAKY
YQCVNGIIYTFYCQTGLVFNSKINQCDWPYNVAGCA
Download sequence
Identical sequences E9GMM9
jgi|Dappu1|304901|PASA_GEN_3100002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]