SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|306237|PASA_GEN_4700044 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|306237|PASA_GEN_4700044
Domain Number 1 Region: 339-404
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000162
Family Tachycitin 0.04
Further Details:      
 
Domain Number 2 Region: 202-216,316-342
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000968
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|306237|PASA_GEN_4700044
Sequence length 577
Sequence
MCMLFPSTPVLGPVALATVQAQYYYPQPSPPFELPGPTPAPTTQAPTPAPTTAAPTPAPT
TPAPTPAPTTPPPPPPPVAPVVEEYTTPSPPPPTTAAPTTLPPPPPTTTAAPTPAPTTPY
VPPPPPPTTAAPPPPVEYLPPVATTTLPPPPPPTTTLPPPPPPTTTLPPPPPPTTTLPPT
TTVYVPPPTTTVYVPPPTTTLPPPPPPTTTLPPPPPPTTTTAYTQPPLEYLPPVTSRPVP
VPTENPLFPDANENQQVSILFPTAAPATTTTTAAPAPTTAAPAPTTTAAPVVVVTTPRPA
PPPVAPVLTEEEEEILFWDFRESIPGEPELDYPIFDKIPVTTFTCDDKIDGYYADVEARC
QVFHVCTAVPNEKSVKNSFLCPNGTIFNQENFACQWWPDVECATSSSFFSLNENIGKVPE
RSPEQQQVVIAAAAPAVVVAAAPEPAKIAEPAVLAIQLPAVIPVIQAQAAAVSESFAAPV
AVEAAAAVEVPAAVEIQQEQIAFVAPAAEIAYESAAAASPEVQAVIIPELPAEIPAPVIL
SIRDEPTQEAIQITLPQAPSGLYEAPDASSSVAQQKY
Download sequence
Identical sequences E9GW02
jgi|Dappu1|306237|PASA_GEN_4700044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]