SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|306822|PASA_GEN_5300101 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|306822|PASA_GEN_5300101
Domain Number 1 Region: 874-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000059
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 2 Region: 778-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 730-779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000869
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 4 Region: 555-619
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000173
Family Growth factor receptor domain 0.0089
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|306822|PASA_GEN_5300101
Domain Number - Region: 214-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00101
Family Complement control module/SCR domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|306822|PASA_GEN_5300101
Sequence length 979
Sequence
MDGLLNQFVRGAHSGRLFGLLRLAHNDLILRRRPCSDRFTVCQLGDAARTASDSRQTTGH
WAANNNNNNLKRHGRRQHNSRPCFICPGSSMLISPDRYDADVAYNGVDAQQHDGAVRMPE
PVVRPCLYSNKYQKGKMRTQVVLGPQPGTVLDQGTHRVVVKVAYQLDSDNNITDRSLIAP
RHHAYCRYTLQVMPSSLAAAEEEEEQSREPVRLCRPPPSPEHGRVACSSVGDDVSITTCR
YTCGEGYVTPKTDRHLVHQDWDCYSDPGTSRPPNFEFRFIFFLLALLAEEVKTSTQFNVF
KRCPDVLECIEFESPVPLDPSQCSGLNLTVPDFDPVQLPLPKFQTPAVNSAVYVTCDLNV
IQAATNGSSINPTVFKRLCVAKNNETDAKFNCNYDIQIHLDPTSGRTVMFAEFRFQLGRL
LPTSSYPTSWCDDRAVVERIMETAKTGLLQSNAEPCQTANCSLLTAQCHREISNNKSSGA
VLNLAWTVAASYQPFSYDDYFYEGSEVPEGEMLIEKIKAETEVLIQTNLDFRKKLETAGG
DLLDKTFQLAKLDLICPLPGYVVNASTNNCQKCPPNTFQQKGVCQLCPERTYQDRAGQTE
CRPCPNRPSVTVKSSEHYNSRCRPSRPDHASIVALTKLPNRKSSSSTIQTRQLSSSASGK
LGKIAAAHTQTSPNHNDKFTSSSKYKNRRHHQHPVSQQPYQQLATGRSAVSRNSFTSPAI
NDTAGIVDDDEDPCSPNPCLAGGTCFRSTRYADNNRIVSSFKCSCRVGTKGIHCETPYCP
TLYCLNGGTCHVNRQVKGHLGRDLLNCTCPLGFTGSRCEHRRQSNNNNHVKIRHNRHHSL
HHQPNGSVNLNGDVTRANKTIGASRGAAGLMGTYCASNPCKNGGRCVDNSHAAPGYFTCF
CPPNFQGELCDFTPCPTSVARTSCPMSFHYPLTSAGRSRKRHSCWIQTSTGRRQCYWPPH
PPSPASKPSSPAAPLYEIA
Download sequence
Identical sequences E9GYR2
jgi|Dappu1|306822|PASA_GEN_5300101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]