SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|308094|PASA_GEN_7400041 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|308094|PASA_GEN_7400041
Domain Number 1 Region: 703-893
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-35
Family Laminin G-like module 0.00031
Further Details:      
 
Domain Number 2 Region: 962-987,1051-1193
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-30
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 3 Region: 945-1019,1221-1268
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000377
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 4 Region: 478-547
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000108
Family Ovomucoid domain III-like 0.0057
Further Details:      
 
Domain Number 5 Region: 100-147
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000194
Family Ovomucoid domain III-like 0.0091
Further Details:      
 
Domain Number 6 Region: 23-74
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000347
Family Ovomucoid domain III-like 0.0049
Further Details:      
 
Domain Number 7 Region: 173-226
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000139
Family Ovomucoid domain III-like 0.0052
Further Details:      
 
Domain Number 8 Region: 232-292
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000137
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 9 Region: 364-410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000219
Family Laminin-type module 0.0084
Further Details:      
 
Domain Number 10 Region: 408-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|308094|PASA_GEN_7400041
Domain Number - Region: 631-718
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.022
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|308094|PASA_GEN_7400041
Sequence length 1296
Sequence
MTGVHPCSKAGCEPDEECQVDEKGMPQCLCKGPCPPIHRPVCGSDQLTYSSNCELERESC
LQKRSIKLLYEGVCGSSEACSNFQCPTGGYCVETASGQPSCHCPLCGGEWDPVCGTDGVT
YTNPCRLRYESCRHNKSLSIVYKGLCNLIDDTKQADGCDKKRCDFYATCETDEMGRAECV
CPKACAKMAITEVCGTDGITYRNECELKQAACRNQQFIVVASKGDCDLCKRVHCEHNARC
EDGICVCPTNCPSPIEPSDPQSVGDVGICASDGRTYLTGCHMQRAACDHGLVLQTITIRL
HPFRIPLTIQLLENATATSKVHKITIDPGVAHSILIRMLCGFLRLRFGAEYKLYWSSKIS
GSLDGACDPVTLQCRCLAGVGGRSCDRCLSGYWGIHSIGTNANGCEPCDCHRLGSIRADC
EQMTGRCVCRANVVGLKCDRCQDGQLVDKVPGGCGGYGGNGGTGSGSDDALESESRHCSD
LTCRFGAICQDLQGQAVCVCPMDCPVASSAEQTVCGSDGVSYGSECDLRLAACRKQLNVV
MAYEGPCSDDIIHTSAGISPLMAAESEMAVSKATRHVQETDVALLDWGRRDIVSLSQVGS
QKANEYYGFSQPVWRPTAASVHVHGYLGESCIDDSQCKLMSNSGCLFGVCKCSDGFAEDS
NSKSCVANVATVSGMEELGPAKISSCSSFPCLGGGTCQPLGMESFVCVCPAERTGSLCER
ALSQSDEEIVPAETPAFHGQSFVELKKMKAQDKFAMEIEFKSLLTDGILLYAQQRKDFDA
DYISLAIIAGHVELRFNLGNGPIVLRSLQPIRLGHWHRVVAQRYRQDGWLRLDDDEDVAT
TSPGEHSTLDLDTNSFLGAVPSHLATARTYDRIGTGSGFVGCMRRVKLGRRSVIFRVPPE
GRKVSRRGRQFDENKRRRNAIDGINKSTVSTVVKMNGITQCGENPCWKTPCANQGTCVWK
TGENYTCVCRPEFTGLTCESALDLCASSPCGDGSTCVSSKNRFTCKCPPGKKGFLCDQHD
GMKHEILVPEFNIVHSPTSASSYVSVARSFQVSQNLDLEVWFLSRSSDGMLAYSARDENG
RGDFIWLALIGGRVQFRWDLGSGAGIVTSSERVTLFNWHRVLVSRRGKEASIRLDDGATS
EGRSLGPLSELNLDIPLFIGGLRHNLTLPRDVPKLENLQGAVQRVIVNGEVFEKLMESEM
EQHNVAVYRGPPCGHMPATHPSSSRIFAYPTSGKDSSSPCQNGGVCQPLLASFVCKCQSG
FLGKRCEKRTDTAEITRPIKFDGKTFLKYPNQLKDV
Download sequence
Identical sequences E9H693
jgi|Dappu1|308094|PASA_GEN_7400041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]