SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|309273|PASA_GEN_9400015 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|309273|PASA_GEN_9400015
Domain Number 1 Region: 239-546
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.46e-37
Family NodB-like polysaccharide deacetylase 0.011
Further Details:      
 
Domain Number 2 Region: 193-229
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 135-177
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000497
Family Tachycitin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|309273|PASA_GEN_9400015
Sequence length 612
Sequence
MESIGSSISLEAKDMRASAPRLQSAAVLEPECTVPNTPALLAVILSPKQSIHSAVIMKFL
WTSLFTVFLASVLVEAQINQIRNAQNAAANNAARRPVEANATPAPTIVDDDSFEKELCKA
KEAGEWFRLQAGEGDNCRDVIQCTSSGLQAIRCPAGLAFDIEKQTCDWKEQVKNCLIKEK
VRKLRPILSTDEPLCQEGMLACHDGTCIERSLFCNGVPDCTDGSDENSCDLSNDPNRAPA
CDPAVCLLPDCFCSETGTEVPGKLDAKQVPQMIMVTFDDAINNNNVELYRDMFNGVRKNP
NGCDIKATFFVSHKYSNYSGVQEIHRKGHEIAAHSITHNDDESFWSTASVDDWAKEMAGA
RLIIDKFANITDNSIVGMRAPYLRVGGNNQFTMMEEQAFLYDSTITAPLQNPPLWPYTLY
FRMPHRCHGNLQKCPTRSHAVWELVMNELDRREDPTFDEDLPGCAMIDSCSNILSGEQFY
AFLNHNFDRHYTQNRAPLGLFFHAAWLKNNPEFMDAFLFWMDEILAKHSDVYFVTMTQVI
QWVQNPQTSSEVKNFEPWKEKCSPVGPSACAVPNSCALTTKELPGETLRLHTCNRCPPNY
PWLNDPSGDGFF
Download sequence
Identical sequences E9HBN3
jgi|Dappu1|309273|PASA_GEN_9400015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]