SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|310994|NCBI_GNO_0300347 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|310994|NCBI_GNO_0300347
Domain Number 1 Region: 247-304
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 2.62e-17
Family Tachycitin 0.01
Further Details:      
 
Domain Number 2 Region: 41-110
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000233
Family Tachycitin 0.017
Further Details:      
 
Domain Number 3 Region: 170-231
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000246
Family Tachycitin 0.035
Further Details:      
 
Domain Number 4 Region: 106-168
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000034
Family Tachycitin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|310994|NCBI_GNO_0300347
Sequence length 305
Sequence
MENQKKIQTILFLNVILLGVVSALSNQFDHTNINPISADNPTDPNFTCPGNGFFPLSPTA
CSTTFYNCVGGIAYIYTCPGEGIFDPSQNTCVSPDQAECTQTTTTTATTTNPGPCMEDGF
FPLSPEACCSEYLNCFDGEAYITICPAGGVFDPNKRICVPADAADCGFVCVAQDGFYDVP
DECSNRYYTCLEGVAYESFCPGNAIFDPDRLVCAAPESVACYYTTTTSTTVTWPYTTQRI
TTTTFSPPVEFVCPSDNGLYPNPDDCKTFYQCTGGKPYIKTCPTGLYFNPETLVCDYLDN
VPSCQ
Download sequence
Identical sequences E9FWA3
jgi|Dappu1|310994|NCBI_GNO_0300347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]