SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|311586|NCBI_GNO_0400360 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|311586|NCBI_GNO_0400360
Domain Number 1 Region: 32-279,350-402
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.69e-102
Family Type II chitinase 0.0000000982
Further Details:      
 
Domain Number 2 Region: 466-706,777-826
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.01e-90
Family Type II chitinase 0.000000459
Further Details:      
 
Domain Number 3 Region: 706-776
Classification Level Classification E-value
Superfamily Chitinase insertion domain 7.02e-22
Family Chitinase insertion domain 0.00017
Further Details:      
 
Domain Number 4 Region: 279-349
Classification Level Classification E-value
Superfamily Chitinase insertion domain 9.16e-21
Family Chitinase insertion domain 0.00039
Further Details:      
 
Domain Number 5 Region: 868-922
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000115
Family Tachycitin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|311586|NCBI_GNO_0400360
Sequence length 928
Sequence
MTQLLLSDCLALYNDGIIMLLLLLYGSADKGYKIVCYFTNWAQYRPKTGKYLPEDIDPHL
CTHIIYAFGWMKKGKLSSLEANDESVDGKIGLYERMMALKNINPDLKVLLAIGGWTFGTA
KFKEMSATRYARQTFVFSAIPFLRQHGFDGLDLDWEYPKGSDDKRNFVSLLKELREAFEA
ESQELKSPRLLLTAAVPVGPDNINGGYDVPAVASYLDFINVMAYDFHGKWENTVGHNAPL
FSPSSDSEWRKQLSVDHASNLWVRLGAPREKLIIGMPTYGRSFQLTDTARFRVNEPASGG
GVQGVYTREAGFLAYYEICEMLRSGKASYVWDDEMKVPYLIMGDQWVGFDDERAIRNKMS
WIKKNNFGGAMVWTLDMDDFTGTVCGNNVKYPLIAAMREELRGIPRPGNDVDWTQEVPTI
SLTATTLPPPIQISLSDILNKVSTKKPQLLLPNVNNAAPVNGSNAKTICYYTSWSANRPG
LGRFSPEEVNTELCTHLVYAFGALKDYRLSLVGSDELDVHARIQTLREKNPDLKIILAIG
GWAVGSAPFKELTSNIFRMNQFVYDSTEFLRANNFDGLDIDWEYPRGADDRASFLNLIKE
LRLAFEGESVTNKMPRLLLTAAVPASPEAIAAGYDVPEVVKYVDFLNVMTYDFHGHWEGQ
VGHNSPLFPLETAASHQRKLTVDYGAREWVKLGAPAEKIMIGMPTFGRTFTLADLSKFDI
GSPASGGGIAGPYTSEAGFLAYYEVCDFLQEDNTTLVWDNEQQVPFAYRDDQWVGFDDER
SLRTKVSWLKEQGFGGVMIYSLDMDDFRGHCGSGRYPLLKAVRQELTADNYQVQFVYDGP
YERSASSLITGKPAPKDPNVVTCDEEEGHISYHPDKANCAMYYMCEGERKHHMPCPVQLV
FNPSQNVCDWPENVPGCETHFTAGTGRR
Download sequence
Identical sequences E9FXB8
jgi|Dappu1|311586|NCBI_GNO_0400360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]