SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|312082|NCBI_GNO_0500251 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|312082|NCBI_GNO_0500251
Domain Number 1 Region: 26-86
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000942
Family Tachycitin 0.044
Further Details:      
 
Domain Number 2 Region: 90-160
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000706
Family Tachycitin 0.021
Further Details:      
 
Domain Number 3 Region: 176-223
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000152
Family Tachycitin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|312082|NCBI_GNO_0500251
Sequence length 226
Sequence
MVKCVATLVYCAFAVNILAYVTNGDPVRLCRKRRFPYYIADSDQCDLFYKCKDGQITEEL
CPDGQVYEPESQACFMIQRVKCGRRKRLQSPQGNALCPRLYGRFPIANECFAYSECEQGT
PTKVNCPPGLIFDIDQAVCEFPDMANRTECSAEKILDFTCPHGSNVQSDEVVLQFGDHER
FPKKGDCRHFFMCLKSGRPRLGGCPLGTIYNPATFFCDKPENVPEW
Download sequence
Identical sequences E9FYS7
jgi|Dappu1|312082|NCBI_GNO_0500251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]