SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|312845|NCBI_GNO_0700118 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|312845|NCBI_GNO_0700118
Domain Number 1 Region: 315-594
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-76
Family Kelch motif 0.000000184
Further Details:      
 
Domain Number 2 Region: 49-166
Classification Level Classification E-value
Superfamily POZ domain 2.2e-32
Family BTB/POZ domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|312845|NCBI_GNO_0700118
Sequence length 626
Sequence
MDSNPGCSGFSQCWKIRSQCNQSSSDQSFASGLDPASYTFTAQGEMKCCIKSYQYDLLKS
LYVMKHNQMLTDVRLDVVNETFHAHKIVLAAASPYFKAMFTSGLREKDASVVKLQGVCPT
VMNKLLTFIYTGEIVINQLVVCQLLPTANMLQVSPVIQACCTFLENQLDPSNALGIAAFA
EQHHCSNLYKAANEFIDQHFIQVCQEEEFLQLSSCQLVALIRRDHLNVREERDVYNAVLK
WVRSNEEHRRPKMEDILGAVRCHYLSPSFLKDQMKNCDILRKVPACREHLAKIFQELSLH
KSPCVPQRTPSAPCVLYIVAGFSRRSLNLFEAFSVSENKWLTLPPLPKSLSGLGGAFLRG
MLYAVGGRENIPDALGHSGYVNAYDPVTSTWHSRADLLQTRHRAGLAVLDGYLYAVGGAS
GKTDLDTVERYNPERDQWELVAAMNTARVGVSAAVVNRLLYAIGGFHGVDRFKSVECFHP
EKNEWLFVSAMNQERSGAGVVAVGQYIYVAGGMGLSGQLSSFERYDTEKDIWTQLSPMLT
ARSALTLAVLDKQIYAMGGFNGTSVVDTVEIYNLETDQWRVGPPLSCPRSGHATAAPFKT
CNFTSATQSRSCPMMKAARNSPLALM
Download sequence
Identical sequences E9G1S5
jgi|Dappu1|312845|NCBI_GNO_0700118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]