SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|313761|NCBI_GNO_0900390 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|313761|NCBI_GNO_0900390
Domain Number 1 Region: 470-643
Classification Level Classification E-value
Superfamily Kelch motif 4.58e-51
Family Kelch motif 0.0000676
Further Details:      
 
Domain Number 2 Region: 44-166
Classification Level Classification E-value
Superfamily POZ domain 6.73e-33
Family BTB/POZ domain 0.0014
Further Details:      
 
Domain Number 3 Region: 343-507
Classification Level Classification E-value
Superfamily Kelch motif 1.09e-28
Family Kelch motif 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|313761|NCBI_GNO_0900390
Sequence length 650
Sequence
MLGYEQGIRNCNACSLSVQQANPSFDSSGDQDNGGQGTDVWDFRDAVFPTVLMDGLNYLR
TSGLLCDVILITGNDEHPAQRVVLAAVSPYFRAMFSGTGTSHEFLESKQNKITLHDIDSA
ILGQILNFIYTAEIQITENNVGDFLVAADFLQINSLQNLCCQYLRSQMNASNCVGIYLSA
KSRNCRELAVNAKRYALEHFRHVVQEEEFLQLPFSELKGILGSHLLNTTGEGELLETITK
WVEHKPSERSQFLQSLVSEIDVWQVPAEKLLSFVNSEILLRRLRDSGFTSEQLQLNDAVV
LGGDFKMAVDKILSQRCDSPCSKAQSHQVAHSKKIRHSYEQEVIVALGGESSGFVLNSME
CYTLGYDGWRCSIPTAVALSGIPNPTQVMPPMRTQRIFPACCSADYTIFVIGGICGGKLI
DSCEFYSVQSNEWISLASLPIGIHGSGAALPNQVLCVIGGRSDQGIEKRAWVYEERFNLW
EALPPMQLHRVHHGVTSLNCLLYAVGGLGGKHTDEQFLSSVECYDPALQRWIPIAPMHEA
RAYCGVVTVGSFLYAIGGFNGISWLRSMERYNPLTNQWTLLTPMSVARSSFGTTVWNGRI
YVIGGCDGIHLLNTVEKFNPRTNRWHCAQAMQVRRLGLGAATVKIPLKME
Download sequence
Identical sequences E9G436
jgi|Dappu1|313761|NCBI_GNO_0900390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]