SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|314628|NCBI_GNO_1200052 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|314628|NCBI_GNO_1200052
Domain Number 1 Region: 2619-2696
Classification Level Classification E-value
Superfamily Immunoglobulin 3.71e-20
Family I set domains 0.0078
Further Details:      
 
Domain Number 2 Region: 2011-2069
Classification Level Classification E-value
Superfamily BPTI-like 5.25e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0031
Further Details:      
 
Domain Number 3 Region: 2373-2463
Classification Level Classification E-value
Superfamily Immunoglobulin 6.38e-19
Family I set domains 0.026
Further Details:      
 
Domain Number 4 Region: 2073-2127
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0046
Further Details:      
 
Domain Number 5 Region: 2146-2199
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0037
Further Details:      
 
Domain Number 6 Region: 1773-1833
Classification Level Classification E-value
Superfamily BPTI-like 2.27e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0045
Further Details:      
 
Domain Number 7 Region: 2464-2544
Classification Level Classification E-value
Superfamily Immunoglobulin 2.29e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 8 Region: 1713-1769
Classification Level Classification E-value
Superfamily BPTI-like 2.41e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0042
Further Details:      
 
Domain Number 9 Region: 1635-1691
Classification Level Classification E-value
Superfamily BPTI-like 3.97e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0037
Further Details:      
 
Domain Number 10 Region: 1453-1510
Classification Level Classification E-value
Superfamily BPTI-like 5.39e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0012
Further Details:      
 
Domain Number 11 Region: 1907-1963
Classification Level Classification E-value
Superfamily BPTI-like 6.81e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0036
Further Details:      
 
Domain Number 12 Region: 1850-1905
Classification Level Classification E-value
Superfamily BPTI-like 1.84e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0029
Further Details:      
 
Domain Number 13 Region: 1515-1568
Classification Level Classification E-value
Superfamily BPTI-like 3.97e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 14 Region: 1574-1628
Classification Level Classification E-value
Superfamily BPTI-like 8.37e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0047
Further Details:      
 
Domain Number 15 Region: 336-394
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000497
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 16 Region: 635-693
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000589
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 17 Region: 458-516
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000085
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 18 Region: 2308-2354
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000262
Family Elafin-like 0.0016
Further Details:      
 
Domain Number 19 Region: 56-106
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000785
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 20 Region: 578-633
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000955
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 21 Region: 390-454
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 22 Region: 519-570
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000353
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|314628|NCBI_GNO_1200052
Domain Number - Region: 201-249
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.00654
Family Diacylglycerol kinase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|314628|NCBI_GNO_1200052
Sequence length 2763
Sequence
MGEKSRLVAGRENQGQSTRHKRQNPGGRSSYILTDFIGVPDPEADVISLQSTKETGKWSD
WSEPSECSRTCGGGVSSQSRECRTSSSDSQCVGATRRHHSCNIQDCPADTQDFRSEQCSR
FNGVPFENRFYEWVPYTRAPNKCELNCMPKGERFYYRHRRKVIDGTLCDEQEGTDVCVAG
QCLPVGCDSMLGSTAKEDQCRVCGGDGTTCTSVNGIAEQNDFQTGYNDVLLIPVGATNIK
IREVKSSNNYLAIRNTTGHYYLNGNWRIDFPREMKFAGCTFHYERKPHAFIAPETITALG
PTTEALYVVLLYQEPNPGIEYEYSFPKDVSLPTGGDSYSWIYGAWSDCSAGCGGGVQTRN
VSCAKTSDFEMVSDDLCDPQLQPVVNRTCASDACDPSWFIGNWTNCSSNCQAGIQFRTVY
CQQVVAGSMQSVINDSVCVNAIGPTPSSTQECNKEAVCPQFHIGDWGPCDKLCGDGTRHR
KITCFRKVDDRIEKLEDSDCEGEVPSRTESCTKRPCEGVDWITSPWSGCKNKCGLEFETR
QAQCVSPKGTVYPDEFCHAYRRPALNRTCAEATKCKHVWFASQWSECSADCGTGIQTRWV
FCGTMDGASPTKVDDENCDPAKRYENSTECHVPPEECKGAWFSGPWSECSKTCGSGSRTR
PILCLANNVTVKIDQCGSDTIPSSEEKCNTQACSEETTPDTTTEMSLVEVCEEVEVDDEE
GEEEEIGEEVIEDPIVESSGSNLGMEPSSGSGSSSDGSGMDTTTDSTMDTTMDSTKDSSM
ESNMESSSGDLAVDMSAEGSGDMGSESSGLGLVLGGMTAPPTVMEGSSEPEGLVRKRRRR
QAPAEELILSNEGSGSGMGSSMGSGLGSGIILGESGSGIDGMDSSELEVEEEMSVIETKN
GLLQSENVLPVDAKPSSKKPAKNETTTKKPTKDAKETSTVKPTKDAKETSTVKPSKDAKK
ETSTQKPTKDAKKETSTQKPSKDAKKDVTTVKPAKSVKKPGVEVIESDIMKTGTKAPPKS
KAKSFPGKKKKVKECRVVTQEKLTCDKTEYGCCSDGVTPAKGPFEAGCPKYETCEDAEFK
CCPDGVTPAKGSNNEGCFTDACKTSLFGCCPDGSTPSEGNDNEGCPEPTTLPPPTTMSSM
GEDLIPVSCKQSEFGCCPDQMTTATGPDNQGCFQCEPSEVEGSGSGSGSGSGAGPECNSC
DDTKFGCCPDNLRAAKGPNGEGCEPVESGSGEIGSGDDVPKTESEINCAETEFGCCPNST
IAATGPGSAGCDSLCAETTFGCCDDNVTSAHGPDKKGCCLNTEFGCCPDNIGVATGPKLE
GCNCEVTQFGCCPDNITPARGEKLEGCGCLYTEHTCCPDSYTPAAGPNYQGCGCNTFEFG
CCPDLITVAKGPNLEGCGCENTAHGCCQDERTPAHGPQFEGCTCESSKHGCCYDGVTASQ
GPNYEGCPSKPKLSGEICALDKDRGSCRNFTVGWFFDMEYGGCSRFWYGGCDGNDNRFPT
QDDCKAHCVEPIGIEACSLPRVAGPCEGNYPSWYHDTTTGSCKQFRYGGCLGNTNRFSTR
EDCNQQCIAPKLLDKCEKPQDAGGCQGTFQRWSYDKTSMTCQEFNWGGCQGNENNFLSER
ECHLRCKDTSRSRVSAEERCNMTADYGRCQGNQLRWHFDSKSRHCHSFLYSGCGGNANRF
ESYQACASICKEAPRTPKTTTPEPYQLTTLRTNDTDSCLLPRAEGPCSEKKSRWYYDQAE
RRCMPFYFGGCQGNANNFESQNACEESCRALSLVTEEDTCRMPRVIGDCKEFTERWYYDE
ADEECRAFLFGGCNGNANNFDSMDSCNQRCKSTVSPIVPESAKPIDEDFRTEFCFLPKQE
GSCDESVLQWFYDRPEGVCKQFIYKGCDGNQNRFADRQECESRCSQSQDVCILPRVVGPC
SGSFRQWYYDAGSDNCYEFDYGGCQGNPNRFNNAQECQNRCQRVRPITTTSTEAPYVPYP
EREDDREREREPEPERRPDERERERERDRYPTGGDICGLEVEPGPCRASVPAWYFNRQTS
RCEAFSYGGCDGNANRFHSEEQCERQCGSFRGQDVCRLPPDRGPCRGSFRKYYFDRSSLQ
CLELVYGGCRGNGNRFSSLEECQSLCLQRAEVAPPGNVTSDANSVVCRLPMDVGPCRERY
DRWYFDSERSTCQPFVYGGCAGNMNRFKSFESCTTFCSPSDRTRPAEPAPSYPSPSTSNE
NEIDVGPPESNNKPYDSEPCSEANANCRAISCPYGIERFTSNSGCDECRCYEPCRGYSCP
EGTECQAELVRDESDPNQSATRIQPACRQVNKEGQCPSIQRRGSNCEEECRSDANCQGDH
KCCFNGCGRSCLAPATTYDEPTTTTPAPARGTPPRIVDGETRVAAEEGSVGEMPCEATGS
PKPTIYWRRANGEAVNDEGKFKIQSNGSLNIIGVHRSDAGMYTCIADNGVGSSALKQIQF
EVKSVTVVTLGSPIIIHCHAYGWPRPSVTWWRGERMLPLSSERYEQFRDYSLLVRRVSFR
DLGPYTCQAYNGYGRPSSHTMILQAIGPVYSVDADEIEFRRYLIPPPQPDPRLLLTTTTT
TPAPFRPRPTPPSSYYTLPPQRPNLVAPNARAWAERSNYPVDSDIQIHCDVQGYPQPTVT
WYKDNNPILPTDRVSVTGNNTLIITGAEGSDSGSYRCEAVNLLGDSTSIISVVVEGVYLH
PNCTDNPFFANCKLIVKARFCTNKYYARFCCKSCTLAGQLPATGPHLLDYKTGTSSASAR
RRK
Download sequence
Identical sequences E9G6Y4
jgi|Dappu1|314628|NCBI_GNO_1200052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]