SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|317955|NCBI_GNO_2200243 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|317955|NCBI_GNO_2200243
Domain Number 1 Region: 48-507
Classification Level Classification E-value
Superfamily Sema domain 2.62e-130
Family Sema domain 0.00002
Further Details:      
 
Domain Number 2 Region: 1392-1518,1761-1947
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-46
Family p120GAP domain-like 0.036
Further Details:      
 
Domain Number 3 Region: 510-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000144
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 4 Region: 877-971
Classification Level Classification E-value
Superfamily E set domains 0.000000000014
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 5 Region: 970-1060
Classification Level Classification E-value
Superfamily E set domains 0.00000000012
Family Other IPT/TIG domains 0.023
Further Details:      
 
Domain Number 6 Region: 1077-1154
Classification Level Classification E-value
Superfamily E set domains 0.00000406
Family E-set domains of sugar-utilizing enzymes 0.093
Further Details:      
 
Domain Number 7 Region: 1190-1238
Classification Level Classification E-value
Superfamily E set domains 0.0000107
Family E-set domains of sugar-utilizing enzymes 0.048
Further Details:      
 
Domain Number 8 Region: 824-856
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000536
Family Plexin repeat 0.0035
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|317955|NCBI_GNO_2200243
Domain Number - Region: 657-693
Classification Level Classification E-value
Superfamily Plexin repeat 0.00183
Family Plexin repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|317955|NCBI_GNO_2200243
Sequence length 1983
Sequence
MASAKQKCPASSSVWPLLHLWLLCASVGGLASAAGPIVATFSEPTGNGGHRLQHLVVDKH
SALVYVGGVNRLYQLSPELERQVTVETGPREDSPECPAVDCLGSVVKRLTDNVNKALVID
YTDTRLIACGTLYQGICSVRNLKNISEELMEVREPVVANNSTATTVVFIAPGPPNPPSTH
VLYVGVTYTGNSPYRSEVPAVSSRSLARHEMFQIAKMEVTTGTRISVNSLSRDRYPIHYV
YGFSSEGFSYFLTTQMRESTNNSPYISKLVRVCQDDRDYYSYTEVPLECVADNGTRYNLI
QAAYVDKPGSDLAAELGIRAQDDVLFAVFAQSDPAEGGEMSNRPAARSALCVYSLKSIRR
KFMHNIQKCFSGEGHRGLDFISPSLPCVHTKLQTIGEDFCGLDVNTPLGGGEPVIERPVC
TMNNVLLTAVAATSTGDFTVVFLGTSKGHLKKVVVENVKGDGGGRGAFEYGDITVDEGSR
VSSDLVFDPQRMHLYAMTERKVTKVRVQDCGVYKTCGECLGARDPYCGWCSLDNKCSLRS
DCQDAAKDPLYWISYKSGRCTTITSVTPNQLQRTTARTLSLVIDNLPTLSGQFQCAFSAF
GKTLLTNATRTANGVSCTTPRTDHIPANPPGQHHFTAKLSVRMTTGPDFVATNFTFFDCT
TYTSCTECVSSSYPCDWCVDGHRCTHDTAENCRNDILVTGVNRIGPSIRSGPGFCPRINA
TASVSTEILVSHGIKKSIKVKVENIAQFIVQTNFVCQFNIEGRVTHVRAQLLGDIIYCDD
MEFTYSSRAPNITATFAVIWGGSKPLDNPDNVHVLIYRCREMADNCGLCLALADKYLCGW
CQTSDKCEVREQCDRSGIGGSVSVATGAPWLDRDQICPNPEVKRFDPRLGPWEGGTNVTI
EGVNLGKTFDDIAGGITVAGMPCHPYEELYVQTRRIVCLVDSPKNSDTRRGPVIVRVSNF
KGESADYYEFVNPVIESIHPSRGPLSGGTQLVIRGQFMNAGSSIQAVIDPSLDCAITSTN
SSHAVCRTSASNRLRSGELQMSFDRGVRRYTRQMYQYVEDPTIEYAESGVVSQVKVPKGV
PSGGIIISVAGNNLEYIQEPKMFVRYRDVVHSSSCQVLSNQRMECRSPAVPVLGQQISPE
EPMSLDYGFLMDDVPSVRNLSHSPNYPKFLLYPDPVYEKFDEEVKYYKSDYLTINGINLD
RACQENDVEVTIGTAPCNVTSLSRNQLTCRPPSAQPPATGANPGDAPEVVVVVGRSLRYV
IGKLSYDSPNSGEGQLPKSVIIGVTIGCGLLIFVFICVVIAYRRKSTESSRVLKSMQEHM
DQLELQVAAECKEAFAELQTEMTDLTSDLTSGGIPFLDYRTYAMKILFPSMEEHTLLQWE
RPDMLRKDKPLRLFGQLLMNKTFLLLFIRTLESNRYFYMRDRVNVASLIMVTLQSKMEYC
TDILKTLLAELIEKCMEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLRECAGEPLYLL
FRAIKHQVDKGPVDCVTSEARYSLSEEKLIRQSIDYKIMTVYVSISPQTIYVSGLEAHTD
NTDTPVKVLDCDTIVQVKDKALDTIYRSTPYSQRPRKEDLDLEWRTGTSGRLVLYDEDST
SKVEGDWKKLNTLAHYRVPDGALLTLIPKQSSMYNLSILSDQHRGGGGGGAADKGHHHKY
ETLNLNLSKFSSASPPMSRATSPMNHHHGDRSHGGGGGGHGTHDRGGDQDPSVKVWHLVR
HHDHDNSRKDGDQRGNKMVSEIYLTRLLSTKITLQKYVDDLFETIFSIANRGSALPLAIK
YMFDFLDDQALQHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDVHKSNIVDSCLSVV
AQTFMDSCSTSDHRLGKDSPSSKLLFAKDIPVYKEWVERYYADIKTMAAISDQDMNAMLA
EESRQHTVDFNVNCALQELYNYADRYYEQLMMALEEDEFSQKQRLAYRLEQVRNLMAAEM
GSP
Download sequence
Identical sequences E9GHF2
jgi|Dappu1|317955|NCBI_GNO_2200243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]