SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|318539|NCBI_GNO_2500119 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|318539|NCBI_GNO_2500119
Domain Number 1 Region: 101-348
Classification Level Classification E-value
Superfamily L domain-like 1.36e-19
Family Ngr ectodomain-like 0.044
Further Details:      
 
Domain Number 2 Region: 383-438
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000915
Family Tachycitin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|318539|NCBI_GNO_2500119
Sequence length 439
Sequence
MHLKCLSLVIASLLLVMTSAMAVQSEGDRAVCPEDFSPCTCDSSAGGQNVVCDQVSVQEI
KSLFSRTTAADLASFKLTTSTSEVSGIPADFLGNTRASSISINCSSTSYELTIDDNAFAS
SATFTKTVSISGCYFVQQRNFNFLSGFGDMTALNIFNSRNFTSFQGLPSQPNLYYISIVN
CRGFDSLVNEGKITLSGLKNLYLYDNELNDRSAATVLSSLASASIESLEELRLYNNRLRR
IPALIPSFSKLNQLMMENNNIDLIITRSLSFYNDVSYLHLGNNAIRSIEPSAFGAHRFGT
VYLHQNNLTRFESYVFQTMLEGMVQAGYGSVSLYENPIDCDCHLAWLILHKPELLAVVDG
GQCSDSIMFTDLNPDAFVDCPVFTCPANIDGNFPNPLSCSSYYVCSNGNDVLVECPGGLV
FNPAYQLCDWAYNVPTCNA
Download sequence
Identical sequences E9GJ45
jgi|Dappu1|318539|NCBI_GNO_2500119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]