SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|324339|NCBI_GNO_6100066 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|324339|NCBI_GNO_6100066
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000254
Family Tachycitin 0.0088
Further Details:      
 
Domain Number 2 Region: 782-840
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000288
Family Tachycitin 0.033
Further Details:      
 
Domain Number 3 Region: 699-763
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000471
Family Tachycitin 0.046
Further Details:      
 
Domain Number 4 Region: 336-401
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000149
Family Tachycitin 0.016
Further Details:      
 
Domain Number 5 Region: 70-125
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000136
Family Tachycitin 0.013
Further Details:      
 
Domain Number 6 Region: 278-340
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000863
Family Antifungal peptide scarabaecin 0.079
Further Details:      
 
Domain Number 7 Region: 219-283
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000191
Family Tachycitin 0.049
Further Details:      
 
Domain Number 8 Region: 870-915
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000146
Family Tachycitin 0.085
Further Details:      
 
Domain Number 9 Region: 152-202
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000288
Family Tachycitin 0.039
Further Details:      
 
Domain Number 10 Region: 643-703
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000575
Family Tachycitin 0.051
Further Details:      
 
Domain Number 11 Region: 585-643
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000288
Family Tachycitin 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|324339|NCBI_GNO_6100066
Sequence length 918
Sequence
MPNGNFEIPGNCTSFYNCTNGVYTIQNCPPDTAFNPVVGACDFTFNVPGCFYLRADEYKT
QTTTTTSKPTTTFSPGFICPMPNGNFEVPGYCTLFYNCTDGVYTIQSCPPDTIFNPVIGA
CDFPFPLPVDPNGCYVLKADEDEKDRLLGIDTNFHCSGNGNWPHPTQCRLFYTCDIHSAI
KRAHLWQCKKGSFYDTKYQRCREFVFKFENIDKTGNEREFVCPGLETGFYPEDENICSAT
YYTCVNGVAYPQQCPGITVFDPVSSTCVDFEVSSCYVPSFTCPSPEGFFPVPATCGSDYF
ICVGGNPSSATCPFQAIFDPVTFACVPQEQASCNQPFTCPSSDGLFPYPGACSAMFYNCT
GSQSSIQYCPGGYYFDPEVLSCVLIEEASCAPGGVTTTSTTTFSSMTSSTPTTLIPTTPE
PFVCPGDGYYSTGVSCTGNFYNCTGGQFYVEFFNFKFDKKKLLSQFSIQFGNLAKLGDFP
DCRLQFSKRHMAVISDEGNSLCSSYLTFYYLSRNLWCKSENIDKTGMKRKIYIFTNPNLP
QSYPQIPHLIGLHDCSLPAVFDPAANLDTISLRIPTKQEREGEFVCPNAETDFYPADPFC
SGSYYTCANSIAYPQNCPGTPGVTAFDPETKTCIPIECAFCYFTCPEPSGFFAVPGTCGD
DYYTCVANQSAPTKCPSGAVFDPVNLDCEPAEEASCHQPFTCPTSDGVFPYPEVCSTFYY
LCTGGQSTVQYCPGGTIFDPELLECVLNEDAPCSPGETPMTTTTPITSTTTPISSTPTTP
EGPFVCPAEGTYPYPGNCSLYYICTAADANPLTVPCPTGLVYNPDTTFCDNPENVPECAV
TDLYYELVDENFSDDDLSKGKKDYSINKGFSCPSDDGYFPNKFVRSHYFACVGGFPYPMV
CPGVTVFDPVKSSCATMG
Download sequence
Identical sequences E9H1M4
jgi|Dappu1|324339|NCBI_GNO_6100066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]