SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|330735|NCBI_GNO_14700002 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|330735|NCBI_GNO_14700002
Domain Number 1 Region: 383-560
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.88e-24
Family Laminin G-like module 0.046
Further Details:      
 
Domain Number 2 Region: 797-819,1023-1182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.89e-24
Family Laminin G-like module 0.0093
Further Details:      
 
Domain Number 3 Region: 71-129
Classification Level Classification E-value
Superfamily BPTI-like 3.83e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0031
Further Details:      
 
Domain Number 4 Region: 1479-1657
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.08e-18
Family Laminin G-like module 0.035
Further Details:      
 
Domain Number 5 Region: 591-777
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-16
Family Laminin G-like module 0.032
Further Details:      
 
Domain Number 6 Region: 185-343
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000921
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 7 Region: 1218-1454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000016
Family Laminin G-like module 0.031
Further Details:      
 
Domain Number 8 Region: 1197-1233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000479
Family EGF-type module 0.009
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|330735|NCBI_GNO_14700002
Domain Number - Region: 804-865
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000139
Family Fibrinogen C-terminal domain-like 0.0093
Further Details:      
 
Domain Number - Region: 358-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0158
Family EGF-type module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|330735|NCBI_GNO_14700002
Sequence length 2122
Sequence
MGHRNGGWTRRTLIFFLLLSLTLADEEHVESGDNTPDLTTDTSITFTDRDDFPDHEETVN
NASLMHPTEETTTHACQTPADPGPCTGELIRFFYDSTALRCRQFIYGGCEGNKNNFGTEA
DCMKMCAHTLVDQPFRDSDQNDFPTDTSVGDKDQMLTLANGHSETSFTFSAEYPFIQLKA
VDISEFKLRQVREIIFEFRSPEAQGLLLYQALRNPPPDEPKYELYVLLEGGELKTIHVFG
ANETTLLVGKGLNRDCWHRVRIRVDPTIASLQVQVDDEIQSIVIEGLDKDEGYGRRQHIN
STLFIGGMNWAQDEVESSYLFEHFVGCLRNVQLKSGSDLSIVTPLKASAHRDIVEGCVDK
CKAGENRCRNGGKCLNRYHSTACDCFGTKYEGDSCDYDSPTTITLRGYSYISYRIYDWKD
RAHSESNRISLLFRALMGDSILFYAGGTFPYTNHVAVTLLANSSLYVEVDFGDGPHGVHL
GEDLTTGVWNNFTLIHNGNTLDFILNGRGQRMLVHGSRYYLRFDPHIFVGGDRKPLGLGL
RSSNNFVGCLSEVYFNDVSILQKLRTNSPHALYHSIFRPEIGQCKDVPVVPITFPFQESK
LSISLQMVPMTEQKLHINLGFKTRNSTAVLAHGTGKTVDGVVGLWELKLNKGEMEFRISE
DATNESLCFVVLKKGQRLADGSWHQVHLVYGQEGVSLAVDYRRPEFKNLNQGNVPSLTLD
EESLIVIGVGYFDSQPGFIGCIRDLVMNRKKLDPRALLSTALVREISLDNCQLVDPCHRP
NACEHGGLCNVDEGRVVCDCTGTGYTGKNCHFALYKRTCEELALLGYMKSGVYEIDIDGN
GPHPPAHVRCEFEANSGVRKTVVEHNLPQDAEIRGRVMDNVVFNLTYREFSAEMLQSLIS
QSLQCKQILRYDCYKAPLELHSYTWFRSAAGNLLDSIPLGKAQPGRCPCSQNQNCKHASV
FCNCDADEPRWLSDEGYLTQPEDLGITQIFALQQRRLVPQAEGRITLGPLECVEANTQQY
VVTFKSPDSYMEVPGWHRGDLAFSFRTSSERAILLYQPLLHPKHPYFRVLLVNEYKLTLE
FSINGEPRSVTVKSSRDLNSGEWQQVWIDYNEYHVRFTVNQESILVDLNDGEEFGPFEAT
LFIGGAPEEMLGSETAVHTDGLVGCFRGLVMNNEVVNLYAYMNARFPDMIQKHCRPSCDP
NPCKNGASCVEFWGSYKCVCKNPMAHFGYNCETGEKAQVHYINQNAVTFRTASSFVEANA
TTLDIANNLGLRGFFHQDILINLRTFDSRSLIFYAYDYHNNFVQLHIEDGNQVVFTFNSA
NTINSVSTVVKGLTSGQSIQILVDREAESTALHVNTAKSIIEAPLSLMQSYARAPWINKE
KEMIKPPRPVRRPEEFYQVFLGGVDEDYMTTSLGGYTGCLRGLSVGGNILDLTSKGADGI
ARDGSEQSGVVHNCNMLCDQQPCQNGGACLEDFRSNTYHCDCEMTSYSGSYCTEEKGAHF
RGDSYITAHYASLDLDAIKIQLAFSTTAVRNIAQALLLIQTSKAKTKYLLVSLTALGYLR
IEDDRGNGVVYGAEVKSVNFLNGARHSVYYKRNGANAILLIDRDDVPLRPLSTSIHPDGL
ADVTDENAIHIGGVKVTNDPRFTDYDHFDGCISNVVVELDGTQLHPLLAYLGYQRSGLEA
VTSHDPEGIEEEARCAAFSITPPGVIEDDMDSYNDTSDQEWLPKPPLILPYKPVFVGPAN
YDPTTSNRILVGLGCIFLAGSIALAIYLCKTHRRSKRRQYLHDDEQLLILQSSVQKQPAN
RPALRNSPVRNVGVTAPNAHVPDDAKLISLSDSNGWKNEFVATSGSGVALNLLDSISSQE
NENQSSSPNDNPNLCGAAPEMLVRYLDDPEADNIVTEVSAEGFSGIVPSIEEAGTISRFI
NSTILNAEMQSETDSKEWPSTHKQHYQAANTTVSPPLEITDESESETLKPKNYECLNGDS
DASKTPLTTALLESMPSIIDMVTDVLRTAKNILEDGVEESSVKNDTVDLMNADNSVLKEL
VDNSLPRNDTSHKVGSEEIPNIPVKRAPIERISESNLSDDDNTSVDLSTEDLELTGATAE
YPASSTDDQLKNQQSTVPGEQH
Download sequence
Identical sequences E9HKH1
jgi|Dappu1|330735|NCBI_GNO_14700002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]