SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|332908|NCBI_GNO_21200002 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|332908|NCBI_GNO_21200002
Domain Number 1 Region: 214-241
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000012
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 184-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000458
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|332908|NCBI_GNO_21200002
Sequence length 304
Sequence
MYYFLASPESEAKDNVDGLQTIEGLAGWDSTECQQLQDRLEALESAVKSIVSALASQKNE
IFAQITAILEQNAALRVILSSPLVSQGVTENSTIHPDFSYKTTINTNSETDQAENLIAVN
QLKGAVKCSLAQLLDIKVSGRRPIDNKYNFRYCSESEGFYCMNIVYRNQQQQYYLRSRGV
TQPGCLNRNQICDGHTDCASGVDEENCDGNCIAGFKCGRQCISKEKVCDGNYDCVDGSDE
HYDCEYAKSCSELKYTYGSFSSLTIDSDNVFIKMPPKKLSSQYRYKATKSFGYLSVCSTL
KKTI
Download sequence
Identical sequences E9HRA4
jgi|Dappu1|332908|NCBI_GNO_21200002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]