SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|333111|NCBI_GNO_22000021 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|333111|NCBI_GNO_22000021
Domain Number 1 Region: 156-216
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000314
Family Tachycitin 0.024
Further Details:      
 
Domain Number 2 Region: 96-155
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000141
Family Tachycitin 0.0075
Further Details:      
 
Domain Number 3 Region: 29-92
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000366
Family Tachycitin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|333111|NCBI_GNO_22000021
Sequence length 241
Sequence
MKANIACVLLALAVSSAAAQQLKATQADPCQAKGKMAADVTYCDRYWECIDGAAEQFDCP
NGLVFAGRARGLLENCDYPWRGDSCEGKQLANTPVSVGPCDWKYGIFGHESSCIRYWTCW
NSTATEQFCIGGLLYNEEKHACDWPEAVEGCQKHPLCKDDANGNVPLGKSCNRYWACQGG
YPRLQRCPATLVFDKRSLRCTNPPTEDCEAPPPPPPEDDPNAPAGPAFVEEEEPAAPAPL
V
Download sequence
Identical sequences E9HRW4
jgi|Dappu1|333111|NCBI_GNO_22000021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]