SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|334688|NCBI_GNO_38700003 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|334688|NCBI_GNO_38700003
Domain Number - Region: 43-101
Classification Level Classification E-value
Superfamily HMG-box 0.000157
Family HMG-box 0.0076
Further Details:      
 
Domain Number - Region: 168-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00128
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|334688|NCBI_GNO_38700003
Sequence length 589
Sequence
MDLFFTKSGKLDDFGWKSKYLKIHELNQRLKDLENFAGIPIALFSKSLFFTLDSSNANVK
ELNDFIGEKWQKTSLEIKQLFYSKANIDMQQVLAQQKDLIQEISKLKETILDNSIEFQSI
ELDENEEIVHFLVPETKVPQYFCRYPRCKSKLANVSSRLKHERTKHSQNKFTCAKCNIVA
ERKETIENHKLRMHNGTRAIKFSRDDQVMKSGTKIPTNDESNIGIIDSISTTDGVVIDDV
VGNSLQNKDSVFDVSSFNATNQDDITDWDDEWNQILESYDLSFLDNSKYLENSFHDQLSS
THNLKEPSITEEAICIDENCPADLKRVPEHNTASSIPKLTNKERLAALLDGRELREVVLD
LDGHDRIQIALDRDMTKLLSFVNGVSVHQFKESDIISANGVVFGPIEKRDNIILAMERDP
AKYPLKVAVKLAMPYSLATPPAVQSTVENVKPPLADPNHLSAGVINKKIAVKVTTPLQQQ
NRSVPNIAPVTSVIRFYSLSTNVKFTHLADFCSQCGPVLHIEKKGATTFVELAVHKTVSN
AFVKRWDGRCNINGTPCVIQTSDFTNFFGKSADAKKEMVDYNAAKNIHH
Download sequence
Identical sequences E9HW68
jgi|Dappu1|334688|NCBI_GNO_38700003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]