SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|380|gw1.12.17.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|380|gw1.12.17.1
Domain Number 1 Region: 11-356
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 9.64e-102
Family alpha-mannosidase 0.000000136
Further Details:      
 
Domain Number 2 Region: 489-1029
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.75e-99
Family alpha-mannosidase, C-terminal domain 0.0000227
Further Details:      
 
Domain Number 3 Region: 364-478
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.6e-27
Family alpha-mannosidase, domain 2 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|380|gw1.12.17.1
Sequence length 1030
Sequence
NWKPEYMRRRDFWDSSLEKRYNEYKKDTTRPSLKVVVLPHSHVDPGWLKTFENYYAQSTH
SILDNLVTKLTQHKNMTFIWTEISFFALWWESALPAKRRQVQKLVEEKRLEFTSATWVMV
DEATPHLYSMLDQMIEGHQWLKSHLGVSPKSAWTVDPFGHGPVAPYLLHAAGLQNTVVQR
IHYGWKRWMADRQVSDFYWKLPWETPGRDSVLCHNFPYDIYTTKHSCGPNPKTCLGYDFR
NVRGEYNEFTMNSSPITRTNIQSKAEVLLEQYAKTGSLTRHNIVLALVGDDFRYDHDIEW
DQQYTNYQNLFNYINARKEIYKTEIGFGTLTDYFDAIRGRVDNFPTLKGDFFPYSDIFSE
GRPAYWTGYFTSRPYYKMLARELEDRLRGAEILYTLALNRARQNGFPTARRVMDHKYGAL
VQARRWLALFQHHDAITGTSKAAVMQDYGQKLFQALKDSANIASSSAAILMSIDDHQWQR
FRLLPALQRPTYDKLAQKTTLELATTEQTEKTVILYNSEAHHRDEMVRLKTSWPYIRVLD
SDGNKIRHQVNPVWTLQHHQRLEPAPESFQLVFIASLAPLSLSAFRIQRMHMPTSQQANE
TAKTLVYSTFDNTTLNGPFKSQRLEQLVDIQVENRKTKLLFDGQTGFLKSIRSKATDRVT
PCAMQFAAYPSSMFHSGAYLFMPDPNAVEPQLDVLKGFNGRPQIFIISGPVMSEVSVVYS
QLLVHSTIIFHKKMEDLIWMETTLDMGPAPNFREHEFFIRFKTGLQNVDPVNGTAEFFTD
QNGFAFARRVRNSQLGVEANYYPITSAAFIQDDNQRLNVLVNSAKGFTSLEKGWMEFMLD
RRTIHDDGRGMGEGMTDNLPTVTPFVLMLEERKESDDKVDRISLPATFASTRLMYPATAF
IVDADESEQVDFVTRTRLLFLNQPLPCNIHMVGLRTLSETGLMEMDLPSNSALLTLHNRA
ADCSITDDLPFSCGATDPEDRVFHPGTSFIGLELGRMERTSLTGLREMGLADFDSARLSL
MELGSFNLTF
Download sequence
Identical sequences E9G740
jgi|Dappu1|380|gw1.12.17.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]