SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|40362|e_gw1.2.317.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|40362|e_gw1.2.317.1
Domain Number 1 Region: 802-1127
Classification Level Classification E-value
Superfamily NHL repeat 9.68e-25
Family NHL repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 491-568
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000388
Family Carboxypeptidase regulatory domain 0.04
Further Details:      
 
Weak hits

Sequence:  jgi|Dappu1|40362|e_gw1.2.317.1
Domain Number - Region: 239-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000119
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 208-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000398
Family Integrin beta EGF-like domains 0.068
Further Details:      
 
Domain Number - Region: 308-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000537
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 1035-1249
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.00131
Family Putative isomerase YbhE 0.037
Further Details:      
 
Domain Number - Region: 340-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00168
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 368-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00454
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 143-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family Integrin beta EGF-like domains 0.091
Further Details:      
 
Domain Number - Region: 172-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 1495-1565,1807-1980
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0392
Family YVTN repeat 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|40362|e_gw1.2.317.1
Sequence length 2379
Sequence
MAGSNTFPARSFPPDGTTFAQVTLGDKISNVIPPYSYWNMQFYHSEAAYVRFELGLPRSA
SLGLYGRRNALPTHTHYDMLHIISGYKSRSRRASTSLVQKEVLHYMEPGHWFVSLYNDDG
DPQEATCLISLARDMTLSCPRGCNGNGECILGRCQCKSGFGGDDCSESVCPVLCSGRGDY
INGQCQCNPGWKGRECSLKHDECEVPDCSGHGKCSGGKCLCGRGFKGEFCDIVDCPHPTC
SDHGFCVDGTCLCKKGWKGPDCALVDSDAMQCLPDCSGTQGAFSLELHKCVCNSGWTGDD
CSKSACGINCGGHGRCEASACVCDPGWAGEFCQERLCDSRCNEHGQCKNGTCLCVTGWNG
KHCTLEGCPRDCSKRGQCKSTEGSGGWSCRCDKGWEGPDCSIPLELECDDGKDNDKDGLL
DCEDSDCCATRHCKKSPFCVTAPKPIDILLRKQPPAVTASFYERMKFLIEEGSLQSYAKQ
DAFNESRSAVVRGKVVAASGLGLFGVRVSSSNPLEGFTLTRDDGWFDLMVNGGGSVVIHF
GRTPFRPTSRTVNVPWNEVIILDVVAMKTEDVPPAPAVSVLCEAHDFDAMRPVVLATWKH
GFQGSCPAQSAILAESQVVQESLEVPGTGAHLVYHSSRSAGYLSTIQLQLTPDIIPQSLS
RIHLRITIEGVLFEKLFEADPGIKYTYAWNRFNVYRQRVYGVTTATVKVGYEYTTCPDVL
WEVQTTKLSGHDMSISDIGGWNLDIHHRYNFHEGILQKGDGSNMYLRYRPEVLRTVMGDG
HQRPLECSSAACEGPAVKQRVLAPVALTASPDGSIYVGDFNLIRRIGTDGNVKTLLRLNA
TRVSYRYHMALSPVDNVLYLSDPEAHQIIRVRNMNDYNDPERNWEPIIGSGERCLPGDEF
NCGDGGLAREAKLAYPKGVAVAADGTVYFADGTNIRAVDKDGLISTVVGNHQHRTHWNPM
PCEGTLPLGEVRLRWPTEIAIDPLDGALHIIDDHMIVRLTSDGRMKIVAGKPLHCPASPT
SDSVDLATQAGLVMPQSLTFGPNGDLYVAESDSQRINRVRRIGTDGRIITVAGAESKCNC
LDSGCNCYDEERHLATASRFNTISAIAVSPDGVLHICDQANYRLRAVTSSLPTETGTSST
TTFDIYSPETQEIYVFNRFGQHVATKSMVTGRNIYLFGYNVNTSNGKVSTVTDSAGNKIF
LLRDYSNQVTSIENTRGHKCRLRMSRTRLLQEFSTPEGRNVTFDYHGSTGLLKSRADSGR
GQSVSYQYDDNGRLISAISPTGEVIKLTFDLSLKGASVQVVHGSRSPVVYFIKPGWSVSK
KIGQAEEVVSMQPDRSVVILTPFGHLTATETSPYGAVLGESDSSLAETFPVPAKQKVEIG
GELVSRLEWRYFVRRRRAEKKDFVQLGKRMRVNGENLLTVEYDKESLSEAVFMEDRAVEL
LNITYDDMSRPISWTPGRSSSFAGVEVSYDRFGQLAMWRQGDLSESYNYDRSGRLAEVVF
ADGNKLIYSFRDAFATLPSQFTTERGHTFLLHHNNIGALQSVTTPRGHIHSFGLQMVPGG
TKFLYHSPASRQPFQLLLDDQGRVQSKLYPVGARIVYLYDDESRLSKIISGVAETSLDYY
SDTGLLKTAEVKERPGYEVRNEFKYHGGLVKEERTKFGSKTGLDNARTRCKYDGNGRLAL
IETELNGRELPPHAFSYNQNLGLLEGVNDLRVYRNAFNRTVIQDSTKHYFRISDRDQHGR
TAMALINIKGYDAFKFELDFDVRGRVHHRRITIGQKLMSYNVTYNAEGGLLQVQHQSQGF
SSAGSLAGVGGRSYVYTYDDNGNILTMSNGEQAKISLVYDAGDRVSSFGEGQTVAYDSRG
FVVRRGALKLAYNDRGQLSYASSETGSSKFRVWYNYDYRGRLSVWRDDKGNVTQFFYTNP
LKPQLLTLLHWPKESRTLRMYYDVNDHLIAVESPEQRWYVASDETGTPLVVFNVHGSVIK
LTERTPFGSTVLDTESTVYIGVDFRGGILSPHTGMIHFGGRVYDPSIAQWLTPEWEHLVS
RLKNPQDIFVYRFRGNDPISIDTEPRYMTSLDDWLQLFGYSWNNIVGAEYSSAAVFSQVS
ETDAKNAVGHFGVISGLRCLTENVQKGFSVLSFVPPPKLRSGGELRRNPLPSIAYRKPAL
GEGILLSRVGGRVSVTLLPDSQGSSGGILQDVLGSVLGDSSTTHWLDIRTGMGQQEIFYF
VKESLAKLRDDQEDLKRLSGQFNITLVENPTEQGGGSELRLANADLSVSISYGVEVEAAR
QRILRSSHRRAVEVAWLREKQLVESGLPGQQVDWSVEERVELMTNGRVDGFVGSDLHSIY
DYPQLADDASNIIFRRDDTKRKRRKSHRLSSRQQRRGQH
Download sequence
Identical sequences E9FSY8
jgi|Dappu1|40362|e_gw1.2.317.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]