SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|51651|e_gw1.26.128.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dappu1|51651|e_gw1.26.128.1
Domain Number - Region: 51-77
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0288
Family Tachycitin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|51651|e_gw1.26.128.1
Sequence length 78
Sequence
MEGAKPFKIGFYYGPSKPDDPNDYLRHFHIEITNLIENGCQYKESNLKIEIAGLCCDAPA
LSFIKLVKSCGAYYCCMK
Download sequence
Identical sequences E9GK63
jgi|Dappu1|51651|e_gw1.26.128.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]