SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|5691|gw1.111.25.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|5691|gw1.111.25.1
Domain Number 1 Region: 1-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 39-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000106
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 3 Region: 81-120
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000223
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number 4 Region: 175-214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000576
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|5691|gw1.111.25.1
Sequence length 214
Sequence
CTSSQFQCINGGCVSIHYNCDGDADCRDRSDEPDSCPPYVCKGEGEYSCPNPHHCIPRSA
VCDGQADCIDKLNEANCSSTHSMCSSTQFYCSHSHIYIPLTWVRDRDSDWQHGEDEDSSV
CDSVVNKPPCPINYLRCPQRPDCMPRIECEHGTDADLCAKLNDSFIETETEKPDCLSSQY
NCFLGSNECIPITSRIYISWVCDGLSDCSNSADE
Download sequence
Identical sequences E9HF68
jgi|Dappu1|5691|gw1.111.25.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]