SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|9229|gw1.727.1.1 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|9229|gw1.727.1.1
Domain Number 1 Region: 1-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 62-84
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000654
Family LDL receptor-like module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|9229|gw1.727.1.1
Sequence length 85
Sequence
CARTEYECFDGKCIPGDMLCDDVVDCIGGEDEKGPFKDLEYPKFTNLKTLNYFPFSSQNL
SQEMIPMSAVCDGKRNCSNGMDERK
Download sequence
Identical sequences E9HYG5
jgi|Dappu1|9229|gw1.727.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]