SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Dappu1|93732|fgenesh1_kg.C_scaffold_220000001 from Daphnia pulex

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dappu1|93732|fgenesh1_kg.C_scaffold_220000001
Domain Number 1 Region: 172-228
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000178
Family Tachycitin 0.022
Further Details:      
 
Domain Number 2 Region: 90-152
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000141
Family Tachycitin 0.0087
Further Details:      
 
Domain Number 3 Region: 22-85
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000251
Family Tachycitin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Dappu1|93732|fgenesh1_kg.C_scaffold_220000001
Sequence length 258
Sequence
MAKFFLAFLFVVASVYGQQADSDCPEKNGVFADTVQCDRYYECENFVLSEKLCADGLVFA
DLGVNSGVGGRCDFPFNVDCKDRPELQPANATANCPRQNGYFAHSDPTVCDQFFFCSSGQ
ANLITCPGGLVFNPNTGTCSWPGEANRAGCQSKDVVAFDCPARVLEADPVGPQFIDPLYA
DPTDCQYFYVCIGGKEPRRNGCTTGLVFNDLTKRCDRPRNVPDCVDWYKTSEGDLLEPDV
LDEVAAPPPKRTNFAGRS
Download sequence
Identical sequences E9HRW0
jgi|Dappu1|93732|fgenesh1_kg.C_scaffold_220000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]