SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375144386|ref|YP_005006827.1| from Niastella koreensis GR20-10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|375144386|ref|YP_005006827.1|
Domain Number - Region: 377-476
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.0251
Family Bactericidal permeability-increasing protein, BPI 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|375144386|ref|YP_005006827.1|
Sequence length 538
Comment hypothetical protein [Niastella koreensis GR20-10]
Sequence
MGGNSKLFAFIFRTIKTSANDPKSKNFLPVMLGNIQSGGAPLLPLKEDYWTIGKLGGASG
LAIAKNIANQYYQIYGTPVIPWPKDPDPSLDLKDPKGVIKVIINGLENVYVSDFTNYDYD
EASAAVTADIKMQFNYWTKNPGGLQPGQKITPLSLNVPFILTQNLCLSNSIDDSTCIDPS
AAPVQIVGEGTFSADITQLNFNASLKITVAPNRSGINLAITKIALVTTGSGAPQFTNIKA
QLTTESEFQEIISDLITSFMSAGDASKAVFTQMEQSLNGADNINAISNTLNTQTGNFLDA
RLGKVTGTLPGDEGQLSTNKVDLYLFDRIRYSLNNPGSDWYVKNLLDNYKNPPLNPFRPE
DLNLGSFDLFAGFKLSNVTLSNVVITGFPNSTVPAASMILAPPNLRIALLLGSLNAGTTA
KADFAATYPGGSLQFGITVTVHSVSLSAVINPDGDDANQLVVTFKSIDFQVPDLSALQIA
LSDQTGMAPAVQKVLNTAEVQQKIVAAIKGQFNDHLKPISGEVTTLIRKLMNQQLGGN
Download sequence
Identical sequences G8TGK0
gi|375144386|ref|YP_005006827.1| WP_014217337.1.59341 WP_014217337.1.81374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]