SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|375147838|ref|YP_005010279.1| from Niastella koreensis GR20-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375147838|ref|YP_005010279.1|
Domain Number 1 Region: 674-756
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 7.64e-16
Family Crystallins/Ca-binding development proteins 0.0011
Further Details:      
 
Domain Number 2 Region: 765-848
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00000000000000265
Family Crystallins/Ca-binding development proteins 0.002
Further Details:      
 
Domain Number 3 Region: 492-574
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00000000101
Family Crystallins/Ca-binding development proteins 0.0026
Further Details:      
 
Domain Number 4 Region: 201-325
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000157
Family Reprolysin-like 0.061
Further Details:      
 
Domain Number 5 Region: 360-459
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000693
Family Collagen-binding domain 0.0095
Further Details:      
 
Domain Number 6 Region: 592-673
Classification Level Classification E-value
Superfamily PKD domain 0.000029
Family PKD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|375147838|ref|YP_005010279.1|
Sequence length 933
Comment peptidase domain-containing protein [Niastella koreensis GR20-10]
Sequence
MKKLSLWLLGSMLFCMAGYAQVKPVSLGKAPDLLTHFRKQFSTAPQQRITGKLALRISTA
DSLPGKINFRQSLAAGQEFVAGEIENVPGSSFFIRFEGLHVQGNIILRNTKKAYTYTSDD
NGNVYISETDIHKVLCIDFDKAPASSAVSAAAAAITAGQLYSLQSYPNANGVVLLDFDGQ
YVSGTGWNGGNPINAAASTLTDAERYEVWQLVSEDYRPFKLNITTSEAVYFSYPANRRMR
CIFTPTNTAAPGAGGVAFLNSFTWGNETPCWVFNGGIKGAGDAAAHEVGHTFGLSHDGRT
NPVEEYYLGQGNWAPIMGAGYYVPVVQWSKGEYANPSQTQDDLSIIANNANGVGYRADDN
SNTRAGATPISIGSTGSAFESGVIETTSDVDFFTFTTAGGAVSLNVNPADKHPNLDVLAT
LYDNNGAVVTASNPDGLNATLSANLAAGTYYVAVTGVGYGDPLTTGYTNYGSLGYYSISG
NIAGGAANAVATFYKDCNYSGSYAVSLAPGAYTVSDLVASGIQDKDISSFTINSGYEVLL
YKNNALQGSFTSFNASTSCLVVNSLNDSVSSLRIRSLTNQSPTVTFLKPVTGNTFLTPAT
VAITVNAADADGTISKVEFYNGATKLGEATTTPYSYTWSNVATGTYTITATATDDRGGQS
SSQVTVTVTNVPIVTVYRDCNYGGTAVGLLPGSYTLSSLQSLGINNDDISSLKVTSGYQV
QLYNDDNFAGTVVTVTSDNSCLVANSFNDLTSSLKISAVGTVTAATVYRDCNYGGTATGL
SPGTYTLTQLQALGILNDDISSLKVTSGYQVQLYADDNFLGNSQTYGVDNSCLVTNGFND
AATSIKIFAIAPAKTQGLITGLQIYPNPVGNELRLRSEEDLTGALIKVYDFSGRELIATR
NNNNRLNVSRLTAGVYTLTVIKNGKIISSRFVK
Download sequence
Identical sequences G8TM94
gi|375147838|ref|YP_005010279.1| WP_014220788.1.59341 WP_014220788.1.81374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]