SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296268516|ref|YP_003651148.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296268516|ref|YP_003651148.1|
Domain Number 1 Region: 216-366
Classification Level Classification E-value
Superfamily Sortase 2.88e-16
Family Sortase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296268516|ref|YP_003651148.1|
Sequence length 368
Comment peptidase C60 sortase A and B [Thermobispora bispora DSM 43833]
Sequence
MSTTPGDAPTPEEQPAASGEGVTPGAASGESASAGPTGHPAHRPADPAPAGPYGTAEGSP
GAPQTPAPPQSPAAPQMPSSPHVPAVQHVPAAQAMPAAQPVPAAQPVPGAAPGRRSLPQP
VLAGMLIAGSLGGIVAVMAGTLALLSPSAEEADPVNAQRAGVSGAALAPTVGPGGTDQPL
TAAAATAPPPDPAARPRRPLTLTPKNASAARMTLARTKGRPVRIRIPAIGVSAPVEPVGV
DAKGEMQVPPLSKPNLVGWYRLGPAPGEQGPAILLGHVNTRAGAAVFYRLRELKRGNKIA
IRRADGKTAIFTVDGIEQVSKLTFPTKRVYGNTATASLRLITCGGLYDAKTHHYTDNVIV
YATLTSVV
Download sequence
Identical sequences D6Y4Y0
gi|296268516|ref|YP_003651148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]