SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296269983|ref|YP_003652615.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296269983|ref|YP_003652615.1|
Domain Number 1 Region: 163-345
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 6.8e-31
Family Thiamin pyrophosphokinase, catalytic domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296269983|ref|YP_003652615.1|
Sequence length 399
Comment thiamin pyrophosphokinase catalytic region [Thermobispora bispora DSM 43833]
Sequence
MMKVPSLNVPGLRRRKVEDLPGITAVARVDRRTKRLTKRLQPGEIAIIDHVDLDRVSAEA
LVACGAAAVINVAPSISGRYPNMGPKILLDAGIPLIDDASPELFERVADGDVIRVRDGMI
YLGDELVGKGQPQTAESVEAAMTEARAGLSAQIEAFAANTMEYIRRERDLLIDGIGVPDV
RTVMEGRHVLIVVRGYHYKEDLATLRPYIREYRPILIGVDGGADALLEAGYVPDMIVGDF
DSVSEKALFSGAELVVHAYRDGRAPGLERVRRLGLEAVVFPATGTSEDVAMLLADAKGAS
LIVAVGTHWTLDEFLDKGRSGMASTFLTRLRVGSKLVDAKGVSRLYRSRISTSSLLLLVA
TTLLTIGVVLSVSPIGQVWLNGFLVAWNGFIFWLVGLFS
Download sequence
Identical sequences D6Y1W6
gi|296269983|ref|YP_003652615.1| WP_013132255.1.18579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]