SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296270961|ref|YP_003653593.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296270961|ref|YP_003653593.1|
Domain Number 1 Region: 247-455
Classification Level Classification E-value
Superfamily Sialidases 0.0000000000000173
Family Sialidases (neuraminidases) 0.022
Further Details:      
 
Domain Number 2 Region: 615-905
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000000139
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.018
Further Details:      
 
Domain Number 3 Region: 428-587
Classification Level Classification E-value
Superfamily Sialidases 0.00000000131
Family Sialidases (neuraminidases) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296270961|ref|YP_003653593.1|
Sequence length 953
Comment hypothetical protein Tbis_3002 [Thermobispora bispora DSM 43833]
Sequence
MASSGPHDRDPQPTADEENPADGSRPSHGAPFTLHHTPPAPPPWAFAAGPVPEGPGGAHP
EPAPERAGESEETARPAGDGSSGPAPGPEHPATPYGEAGPGETARPGDPLSAGIRPDGRP
RRLTDRPDVLVAIGPPRRPRAGSTGADPGPPRAGSQEDAGGTRAAQGTAAPPLPVRRPAR
LPAVPGRPPAAAARAHGRGLLRRPVVLAVVAALCLAAGALGLLALRSGTADGGWLTGGEG
LVADAAFPARGGRSHVLNAVAAAGSMIVAAGSDTTGPRPRPLFLVSPDEGETWEAGRTLG
PAAGAAGAVGRVASGGGRWLAVGTDATGRAGHAMWTSADGRSWTPVDPARLAAFAPGDRV
SDLAGGEQGFAAAGVTTRPDGTPGPVVWLSPDGERWTRVDDRGGLPGRIGGIAAIAMRGD
RVVALADAGGSASVVLRSDDGGRTWRAGESSLPGVRAEPGALAATERGFVLVPVRQRTAD
GRVPVYCSPDGGRWTGCGAIGGLGPDGPGVRAVGASEAGVAALVETEWGRYTAYTSADGG
AWTRAAELGEIPGTLRGLTITGAGLLVAGGDRRGRGDVENLPVLVTARAGGSVTAVPPER
IAGLRRDAGEVADLAAAGGTFVAVGSADGDAAIWTARDGAGWAAAGPAGPLSGPGRQELT
GVAHGPEGWLAVGSTTPEPALTRPLLVTSADGRTWRPGPEIEAPADHPALAPVAVAAGPQ
GYVIAGEDHGPDGARPALWFSADLTRFARIPAESLPDEGAGVRLAGVTATPDGFAAVGSA
GRDGRETGIVWRSADGRAWTAAARVLPPGARSAALHRVVSVRSALVVLGTAATGDGARPF
SAVSTDGGATWRYGRPPAEETAAVLDVAVTARGLVAVGADGAAGAGDGTVWLSADGLAWT
RHPLTAEPLGGPGDQWLGLVAASGDRVVGVGGSADEDGEHVIVWRTTVAAAGG
Download sequence
Identical sequences D6Y7I9
gi|296270961|ref|YP_003653593.1| WP_013133233.1.18579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]