SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296271214|ref|YP_003653846.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296271214|ref|YP_003653846.1|
Domain Number 1 Region: 81-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000811
Family NfeD domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296271214|ref|YP_003653846.1|
Sequence length 143
Comment hypothetical protein Tbis_3263 [Thermobispora bispora DSM 43833]
Sequence
MDLWLVWLIIAALLGIAEIFTLTAALGILGAAALLTAGIALLGLPLGAQLLVFAAASTAG
IVVVRPIARRLLRQPAPQRFGVSALIGKPAYVIKEVTAHDGRVRIGGEEWSARAYDESLV
IPAGTTVDVIQIEGATALVYPRE
Download sequence
Identical sequences D6Y8Z1
gi|296271214|ref|YP_003653846.1| WP_013133486.1.18579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]