SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296271492|ref|YP_003654124.1| from Thermobispora bispora DSM 43833

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296271492|ref|YP_003654124.1|
Domain Number 1 Region: 93-217
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.49e-27
Family GntR ligand-binding domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.24e-23
Family GntR-like transcriptional regulators 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296271492|ref|YP_003654124.1|
Sequence length 235
Comment GntR family transcriptional regulator [Thermobispora bispora DSM 43833]
Sequence
MSLRTAQRASLVDQVIDQLKEQITSGYWQLNAKIPTETALAEQLGVGRNTVREAVRALTH
AGLLECRQGDGTYVRATSELSGVMARRLRAAEQLEILEVRRALEVEAARLAAIRRTDEDI
AAMEAALAEREKAWAEGDPETFVEADLNFHVTVVAATHNQVLMDLYLDFSAALRSSIRTA
GGSLKENYIPHDTIVRAIVAGDAAAAERAGHACMEHILIALTENAGDGSSSPGDD
Download sequence
Identical sequences D6YAH8
gi|296271492|ref|YP_003654124.1| WP_013133764.1.18579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]