SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300114300|ref|YP_003760875.1| from Nitrosococcus watsonii C-113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300114300|ref|YP_003760875.1|
Domain Number 1 Region: 39-106
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000523
Family Coronavirus S2 glycoprotein 0.01
Further Details:      
 
Weak hits

Sequence:  gi|300114300|ref|YP_003760875.1|
Domain Number - Region: 57-212
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00863
Family HBL-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300114300|ref|YP_003760875.1|
Sequence length 216
Comment hypothetical protein Nwat_1677 [Nitrosococcus watsonii C-113]
Sequence
MLNVTLRALLTSLFLWLLIGCQTAYYKTMEEFGYHKRDILADRVEEVRDTQIEAKDQFQS
ALEQFSSVVNYDGGDLEALYEKLNDEYQASKKEAEAVHDRIASVEDVAGALFVEWQEELD
QYDNPSLRRSSQQQLTQTRTRYDKLLRAMKRAEAKIQPVLATFHDQVLFLKHNLNARAIA
SLQGELSTIETDVNRLVQEMEAAIDEANTFIKTLES
Download sequence
Identical sequences D8K6M7
gi|300114300|ref|YP_003760875.1| WP_013220646.1.90395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]