SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297559774|ref|YP_003678748.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297559774|ref|YP_003678748.1|
Domain Number 1 Region: 17-277
Classification Level Classification E-value
Superfamily Cgl1923-like 1.12e-79
Family Cgl1923-like 0.00000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297559774|ref|YP_003678748.1|
Sequence length 319
Comment hypothetical protein Ndas_0798 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MIPTSFGDENPVRDSADLYELHPGFEDVAGLAMLVCLDGFVDAGHAGRQLITSLFERFTA
EEVATFDADRLVDYRSRRPTMTFVENTWTAYDAPKIALYRLHDDEGAPFLVLHGPEPDRE
WEAFAAAVGRLVDHFSVTLSVSVHGIPMAVPHTRPVTVTPHSTRPELVEGHTPWIGRVEV
PGSATSLLEYRLGERGHDFVGYAVHVPSYLAQAQYPRAAIAAAEYVAGATGLALATTEME
EVAAATDVDIAEQVMASEEIQRVVANLERQYDDIMSSRTDPEERPTLPLADDDAQLPTAD
ELGAELERFLAEREGEGNG
Download sequence
Identical sequences D7AZF0
gi|297559774|ref|YP_003678748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]