SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297562377|ref|YP_003681351.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297562377|ref|YP_003681351.1|
Domain Number 1 Region: 81-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000209
Family NfeD domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297562377|ref|YP_003681351.1|
Sequence length 146
Comment hypothetical protein Ndas_3440 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MDAWLIWLILAVGLGVVEVFTLTFVLGLLAVAALVAALLGAIGLPVAAQIIGFTATAAAG
IYLVRPIMRRQLRGGPVVRSGAQALVGRSAVVLQEVGADRGRIKLSGEEWSARCIDEDLV
IPVGTRVDVMEIDGATAVVYPREALP
Download sequence
Identical sequences D7B3S8
gi|297562377|ref|YP_003681351.1| WP_013154452.1.70090 WP_013154452.1.87825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]