SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297563792|ref|YP_003682765.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297563792|ref|YP_003682765.1|
Domain Number 1 Region: 4-363
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 3.53e-47
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297563792|ref|YP_003682765.1|
Sequence length 367
Comment glycosyl hydrolase family protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MAYLLVIGTRKGLFTARSEDRRAWEVSGPHRLDSADYASMSAVYAVGVNPHSGRILAGAE
SSHFGPSVWYSDDGGATWHEPGSAPIAFPEDTDASLVRAWQFAFGDDADTVYAGVEPHAL
FRSSDGGLRFELVRALWDHPHRADWFPGAGGGAVHTILPGILGAGERVPGAVTVAMSTGG
VYQTRDDGASWAPANRGISAVFLPDEEPEYGQCVHKVAAGPGGVLYAQNHHGVYRSSDPA
GKGWTAVETGLPTDFGFAVVAHPHRPETALNFPVVSQEVHLPPDHRLGVYRTDDGGGSWR
PFTQGLPREPYFGIVLRDGACTDGADVPGFYFGTRSGDVYAATDGGDGWHPVVQHLPDVL
CVRAAEV
Download sequence
Identical sequences D7B7V1
gi|297563792|ref|YP_003682765.1| WP_013155866.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]