SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297564474|ref|YP_003683447.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297564474|ref|YP_003683447.1|
Domain Number 1 Region: 51-457
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 5.23e-80
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000467
Further Details:      
 
Domain Number 2 Region: 474-772
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.1e-37
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000658
Further Details:      
 
Domain Number 3 Region: 801-905
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.19e-34
Family Cellulose-binding domain family II 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297564474|ref|YP_003683447.1|
Sequence length 906
Comment cellulose-binding family II protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MPPEQHRPPRRGRGLPALAVAAATALAASTVVATTAAGAAPAEPTAAQDAYEWDNVEIVG
GGFVPGIVFSETEPGLAYARTDIGGAYRWNPDTERWIPLLDWVGWDEWGYTGVVSIATDP
VDPDRVYAAVGTYTNGWDPNNGAILSSDDRGETWDVAELPFKLGGNMPGRGLGERLAVDP
NDNSVVYFGASGGNGLWRSTDHGATWAEVEAFPNPGDYVQDPGDETGMMSDITGVTWVDF
DPRTGSEGSVTQDVYVGVADLDDPVYRSQDGGQTWEPVPGAPTGHLPAHSVVDHEGGQLY
MATTSTPGPYDGDSGDVWRMDLATGEWTDISPVPSGSEDNYFGYGGLTIDRQDPDTLMVA
TQISWWPDIQIYRSTDRGQTWTQAWDWGAYPERTTRYEMDISGAPWLDFGGTGTPPETQP
KLGWMTQAMAIDPFDSDRFMYGTGATVYGSDNLTDWDAGTTFDIGVRAHGIEETAVNDLI
SPPEGAPLHSALLDIGGFTHQDLETVPDQMYQQPYWGHGTSLDFAELQPATIARVGGSDA
EAAIGLSTDGGESWWAGQEPGGVTGGGTVAVNADGSSVVWSPDGTGVHVSTTLGSSWTAS
TGVPAGARVEADRVDPDVFYAVSGGTFYTSTDGGATFTAGFDGLPAEGNIRFGAVPGHTG
DVWVAGGTGDHYGMWRSTDAGASFEQVEAVDEGDAVGFGAPAPGSDYPAVYTSSRIDGVR
GIFRSDDAGESWVRINDDQHQWAWTGATITGDPNVYGRVYVGTNGRGIVYGDLAGGGGDP
EPTPEPTPDPEPTPEPSPDPEPGDCAVEYTVTNTWSGGFQAGVTVTNDGDEALEGWEVGW
EFTAGEEVTSLWNGAYTQDGASVRVTDAGWNARIAPGSSVTVGFNGTVDGEPAQPTGLTL
DGEACG
Download sequence
Identical sequences D7B9T3
gi|297564474|ref|YP_003683447.1| WP_013156548.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]