SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297563326|ref|YP_003682300.1| from Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297563326|ref|YP_003682300.1|
Domain Number 1 Region: 176-447
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.08e-45
Family Protein kinases, catalytic subunit 0.0012
Further Details:      
 
Domain Number 2 Region: 530-653
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000696
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297563326|ref|YP_003682300.1|
Sequence length 781
Comment serine/threonine protein kinase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
Sequence
MTKCTVPGCPGRVEDGFCGVCGMAPADVRPPDGPAPRQRPVPPTSGPQPSLGANSSANPL
SGDPVHSHPLSGNVRLSGRSGPGSVSATSGASVSGAGRGSRRSSRGMLGMGMVQVPLVPY
RDPSEAVMDNPVVAEKNRFCGNCGERVGRTQGDQPGRTEGFCRKCGTQFSFTPKLSPGDL
VGGQYEVLGCLAHGGLGWIYLARDRNVNDRWVVLKGLLNAGDAEAHKAAAAERAFLSEVE
HPNIVKIINFSQHPDPRTGIPGGHIVMEYVGGKSLRELLIERREDDPDAVLPPDQVIAYG
LEVLRALGYLHSRGLLYCDFKPDNVIQSEEQIKLIDLGGVRRMDDTVSPVYTTPGYRVPE
EELRGPGPTVSADLYSVGRALAVLSFRFSFMRDHPHSIPPRETVPLLQRHPSFDRLLRRA
THSEPELRFHDAEDMADQLTGVLREVLSDLEGTPHPAPSTLFGAENPAARPDPGAHNADR
MLLAPPPTDAAALLPAPLIDQSDPAAQHLRGFQTLPPEELVPALRAMPSPTPETLLMLVR
ALVTVGRQGEAMDVLQRFSEVVPGDWRTMWYLAVAELSTGRFRDARDHFDELYDHLPGEL
APKLALALACERTGEHETAARLFRAVWNTDRSFVSAAFGLARIRLVQGDRAAATAVLDTV
PELSRLHVHAQTALIAVLAAHHQGTGAADFVQAGRRLERIGLDGESADRLAVRVLESALG
WFGAGAGASAGEELLGAPFTENGVRANLERRYRALAQRAVAPSERYELVDRANSLRPVTL
L
Download sequence
Identical sequences D7AX24
gi|297563326|ref|YP_003682300.1| WP_013155401.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]