SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300716185|ref|YP_003740988.1| from Erwinia billingiae Eb661

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300716185|ref|YP_003740988.1|
Domain Number 1 Region: 17-203
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.32e-41
Family Phospholipase D 0.029
Further Details:      
 
Domain Number 2 Region: 256-452
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.03e-31
Family Polyphosphate kinase C-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300716185|ref|YP_003740988.1|
Sequence length 490
Comment phospholipase YmdC [Erwinia billingiae Eb661]
Sequence
MAEAYTPEPDEPDFEQTRLTRAVSPLVDNHPDHSGIHPLEDGLDAFAARYLLMTMAEHTL
DIQYYIWQNDMSGRLLFSAVLEAAERGVKVRLLLDDNNTMGLDETLSQLSKHPNIEIRLF
NPFSFRTLRALGYLTDFARLNRRMHNKSFTVDGEATIVGGRNVGDEYFGAGEEPLFSDLD
VLAIGPVVAEVTKDFERYWKSRAVEPFSKVVDLDDAAANSAVSLPEAWHSDPQVERYLER
IHASPFVAQLESGDLRLIWANTRLLSDDPRKGLGRAKAGSLLPQRMLEVIGKPQTQFDII
SAYFVPTRAGVAQLLSLVRKGVKIAILTNSLAANDVSVVHAGYAKWRKKLLRHGITLYEL
KPHTDNRDKPHDRGLTGNSGSSLHAKTFSVDNEKVFIGSFNFDPRSAMLNTEMGFVIESE
YLASSIHQRFITRMRDRAWTLRLDKWGRVNWVEYPGEGEKEIVHKHEPRTRFMQRLLVRL
VWRLPIEWLL
Download sequence
Identical sequences D8MQN0
WP_013201630.1.56564 gi|300716185|ref|YP_003740988.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]