SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298489661|ref|YP_003719838.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298489661|ref|YP_003719838.1|
Domain Number 1 Region: 78-119
Classification Level Classification E-value
Superfamily AbrB/MazE/MraZ-like 0.0000506
Family Kis/PemI addiction antidote 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298489661|ref|YP_003719838.1|
Sequence length 145
Comment transcriptional regulator AbrB ['Nostoc azollae' 0708]
Sequence
MTETATAPLTGKALLAKVKELSNLPRRERAKQCGYYTVTKNNQVRVNLTDFYDALLSARG
IPLSPEAPKDGRGREPTYRVSVHQNRQIVIGATYTKAMGLKPGDEFEIRLGYKHIHLIQL
GESDKKLTAPDIDADEADLEDEEEN
Download sequence
Identical sequences D7DVE0
WP_013189735.1.25658 gi|298489661|ref|YP_003719838.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]