SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298489783|ref|YP_003719960.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298489783|ref|YP_003719960.1|
Domain Number 1 Region: 251-728
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 5.1e-111
Family Glycosyltransferase family 36 C-terminal domain 0.000000278
Further Details:      
 
Domain Number 2 Region: 4-250
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.96e-68
Family Glycosyltransferase family 36 N-terminal domain 0.0005
Further Details:      
 
Domain Number 3 Region: 744-946
Classification Level Classification E-value
Superfamily HAD-like 3.69e-46
Family beta-Phosphoglucomutase-like 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298489783|ref|YP_003719960.1|
Sequence length 965
Comment beta-phosphoglucomutase ['Nostoc azollae' 0708]
Sequence
MENKRDFIYTDWVLIENQFNPDELHTRETIFTIGNGYLGTRGSFEESYPRTLSATFIHGV
YDDVPVVYTELANCPDWLPLVVMIDSERFRLDQGKILEYNRKLDLHQGILSRYLRWRSPT
GKTIDISFERFASLAENHVLGQRCQLTTIDFHGFIEIQASINGYPENKGFNHWEKLDQGK
IDKGFWLHSRTRYSRIDLGMAAKMTISGIETAMQVNTAPGYPSISTTFFSEPQQTVTIEK
IATVFTSRDVEQPVSAAQEKLDQLPDYITLSNANEQAWAEVWDKSDITIEGDNTATFAVR
YNLFQLIIAAPRDDDRVSIPAKTLSGFGYHGHIFWDTEIFILPFFTFTQPALARNLLSYR
YHSLNGARRKATHYEYQGAMYAWESAVTGDEVTPRWSLPSDYYAEDVRIWCRDREIHISA
VITYAVWYYWQVTGDDEWLRDYGAEIILDTAIFWNSRVEFNPQAERYEIRNVIGADEYHE
LVHNNAFTNRLVQWHLEKACIVDDWLRRHVPEKATELEKKLQLTDEIRNHWLEIINKIWI
PYNPETGLIEQCEGFFQLDDINLADYEPRQKSIQSILGIEGTNKRQVLKQPDVLMLLYLM
RKNAVFPYNLKTLQVNWDYYAPRTDITYGSSLGSAIHAILAADLGQTQEAYERFMQAAMV
DLADRRGNTSDGIHGASAGGIWQAVVFGFGGIQFTDSQPVANPHLPPHWTRLKFKLYWHG
KWQDFDLHQELGTGNGRRNPATAIRGMIFDLDGVLTDTAQYHYLAWQRLANEEGIPFNRQ
ANEALRGISRRASLMLIIGDRRYSEVQIQEMMERKNDYYVELIQRITPKDLLPGAVSLLD
DLRQARLKIAIGSASKNARVVIEKLGIGNKIDAIADGYSVQKPKPAPDLFLFAAQQLGLS
PQQCVVFEDAAAGIDAALAASMWAVGIGPPVRVGTAHIVVPSLAGVTWENLQGKFRDIAL
QKLRN
Download sequence
Identical sequences D7DYL4
gi|298489783|ref|YP_003719960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]