SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298489912|ref|YP_003720089.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298489912|ref|YP_003720089.1|
Domain Number 1 Region: 30-267
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.83e-66
Family Alanine racemase-like, N-terminal domain 0.0000119
Further Details:      
 
Domain Number 2 Region: 259-393
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 5.23e-50
Family Alanine racemase 0.0000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298489912|ref|YP_003720089.1|
Sequence length 395
Comment alanine racemase ['Nostoc azollae' 0708]
Sequence
MFSSKQTPSFADSQERDTYAWFSQRAWVEIDLGALSYNVKQLVIFLSSRTQLMAVVKADA
YGHGSVTVAKTVLEAGASCLGVATVPEGIQLREGGIKAPILILGATHTLEQIHAIAQWKL
QPTLCSPKQALEVSNTLEAINYNSPIPVHIKLDTGMSRLGTNWQEAGDFVQLVQGLPHLD
IASVYSHLATADSPDPAIMQQQHNRFEQAIAQIKARGIKIPSLHLANSAATLADPKLHYD
MVRAGLAIYGLYPATHLENKIKLQPVLQLKARVTHVKTIAAGTGVSYGHQFIAPREMRIA
VVGIGYADGVPRSLSNQMQVLLRGQRVHQIGTITMDQIMLDVSSIPDLQEGEIVTLLGEQ
GQEQISADDWANQLNTISWEILCAFKHRLPRVAVI
Download sequence
Identical sequences D7DZL4
WP_013189985.1.25658 gi|298489912|ref|YP_003720089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]