SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298489932|ref|YP_003720109.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298489932|ref|YP_003720109.1|
Domain Number 1 Region: 3-269
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.24e-26
Family Tryptophan biosynthesis enzymes 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298489932|ref|YP_003720109.1|
Sequence length 282
Comment photosystem I assembly BtpA ['Nostoc azollae' 0708]
Sequence
MDLYQLFKTRTPIIGVVHLLPLPTSPRWGGSLKAVTDRAEQEATALASGGVDGLIVENFF
DAPFTKNQVDPAVVSAMTVVVQRIQNLVTLPVGLNVLRNDGKSAMAIASCVRAQFIRVNI
LTGVMATDQGLIEGEAHQLLRYRRELGSDVKILADVLVKHARPLSSPNLTVAVKDTIERG
LADGVILSGWATGSPPNLEDLELACGAAAGTPVFIGSGANWENIGTLMQAANGVIVSSSL
KRHDQISQPIDPIRVSQFVEAAHRNWNSKGESKSSSSIKLHS
Download sequence
Identical sequences D7E077
WP_013190005.1.25658 gi|298489932|ref|YP_003720109.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]