SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490157|ref|YP_003720334.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490157|ref|YP_003720334.1|
Domain Number 1 Region: 104-318
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 7.6e-57
Family BC ATP-binding domain-like 0.00000607
Further Details:      
 
Domain Number 2 Region: 1-102
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.44e-35
Family BC N-terminal domain-like 0.0000672
Further Details:      
 
Domain Number 3 Region: 329-424
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.73e-31
Family BC C-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298490157|ref|YP_003720334.1|
Sequence length 428
Comment phosphoribosylamine/glycine ligase ['Nostoc azollae' 0708]
Sequence
MKVLVVGNGGREHALAWKLLQSNKVEQVVCVPGNGGTATLERCQNLPLAVDDFEGISQFA
LKKGISLVVVGPEVPLSNGITDYLQNQGLMVFGPVKAGAQIEASKAWAKALMQEAGVPTA
TAAVFRESAAAKSYLQAQGAPIVIKADGLAAGKGVTVAETIEQAESAIDTIFQGQFGSAG
NFVVIEECLLGQEVSVLALTDGLTIRPLLPAQDYKRIGEGDTGENTGGMGAYTPTPIATP
ELMARVQTEVLEKTITALRNRGIDYRGVLYAGLMVAPNGDFKVLEFNCRFGDPETQVILP
LLETPLEDLILACIDQRLREMPPLAWKEGAAATVVAASGGYPGDYEKGKIITGIQKAEAA
GAIVFHAGTKLNSAQQIITEGGRVLNITGTGENFQEAIAQVYTGIKHIQFPGVYYRRDIG
HRVLKIET
Download sequence
Identical sequences D7E1I4
gi|298490157|ref|YP_003720334.1| WP_013190229.1.25658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]