SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490360|ref|YP_003720537.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490360|ref|YP_003720537.1|
Domain Number 1 Region: 74-246
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.34e-37
Family Cyclophilin (peptidylprolyl isomerase) 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298490360|ref|YP_003720537.1|
Sequence length 260
Comment cyclophilin type peptidyl-prolyl cis-trans isomerase ['Nostoc azollae' 0708]
Sequence
MRLKFPQFLMLMLMIGGLILGGCSTEKVASNTSPASTAASKATEASSNSTAEAAISQTSS
ESIPGMKDLPRLEGKANVVITVKGAPITIEVDGVNAPITAGNFVDLVQKGVYDGLVFHRV
VRDPQPFVVQGGDPQSKDPKVPANRLGTGGYIDPKIGTERRIPLEIKPEGAEEPVYSQTI
ARKPLLTHKQGAVAMARSQLPDSASSQFYFALADLGFLDGSYAVFGYVTDGFDVVNQIHQ
GDRIDSAKITKGAQNLKSTK
Download sequence
Identical sequences D7E2N7
WP_013190432.1.25658 gi|298490360|ref|YP_003720537.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]