SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490423|ref|YP_003720600.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490423|ref|YP_003720600.1|
Domain Number 1 Region: 122-291
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 4.58e-39
Family Succinyl-CoA synthetase domains 0.0000139
Further Details:      
 
Domain Number 2 Region: 3-121
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.02e-23
Family CoA-binding domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298490423|ref|YP_003720600.1|
Sequence length 295
Comment CoA-binding domain-containing protein ['Nostoc azollae' 0708]
Sequence
MNLRADSRILIQGFSEFISATHIAQMKAYGTNLIAGVQPGCGGQMKYDLPVFDLVEEAIS
KLGAIDTTIICVHPYQVLDAALEASASNIRQIIIISPGVPPLHMVTLLRKTETREILVVG
PNSPGIIVPGKILLGTQPSEFYTPGSVGIVSRSSTLTYEVAWELTQAGLGQSISVSIGSD
AIVGSSFLQWLQILDEDETTDAIVLVGQPGGGSEEAAARYIAEAIDKPVIAYIAGRHAPQ
SKYWHQTGNIATVVRRDPNFGTTQNKLAAFQAAQVPVAEYPAQIPEFLKKVMGNT
Download sequence
Identical sequences D7E2V0
WP_013190495.1.25658 gi|298490423|ref|YP_003720600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]