SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490430|ref|YP_003720607.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490430|ref|YP_003720607.1|
Domain Number 1 Region: 258-403
Classification Level Classification E-value
Superfamily Flavoproteins 3.92e-41
Family Flavodoxin-related 0.0042
Further Details:      
 
Domain Number 2 Region: 416-564
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.77e-36
Family NADH:FMN oxidoreductase-like 0.0028
Further Details:      
 
Domain Number 3 Region: 11-249
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.77e-32
Family ROO N-terminal domain-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298490430|ref|YP_003720607.1|
Sequence length 569
Comment flavin reductase domain-containing FMN-binding protein ['Nostoc azollae' 0708]
Sequence
MLETKPRDIQILPIGTDTTILRARSWTRLRFEIEYALAKGTTANSFLIQGDKIALIDPPG
ETFTEIYLAALQQRIDVETVDYVILGHVNPNRAATLRTLLEISPQITFVCSNPGAINLKA
ALENQDLPILVMRGEETLDLGKGHHLQFIPTPNPRYADELCTYDPQTEILFSDKLFGAHT
CGDQVFDEGWEIFNEDRRYYFDCLMAPHARQVETALDKLSDLPVRLYATGHGSLVRYGLI
ELTHSYREWIQQQTNADMTVTLIYASAYGNTATLAQAIARGITKAGVSVESINCEFADPE
EIKTAVEKSAGFVIGSPTLGGHAPTPVQTALGIVLSTATNNKLAGVFGSFGWSGEAVDFI
ESKLKDAGYRFGFDTIRVKFKPNEVTLQTCEEAGTDFAQALKRAAKKAVVARQPATNVEQ
AVGRIVGSLCVVTATQGEVKTGMLASWVAQASFSPPGLTIAVAKDRAMENMTHTGNEFVV
NILTEGREIRKQFMKVYTPGQDRFAGLAMEEASNGGVILSGALSYLECSVQSRMEVGDHW
LVYATVNDGKVLNQDGVTAVHHRKSGSYY
Download sequence
Identical sequences D7E361
WP_013190502.1.25658 gi|298490430|ref|YP_003720607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]