SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298490442|ref|YP_003720619.1| from 'Nostoc azollae' 0708

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298490442|ref|YP_003720619.1|
Domain Number 1 Region: 3-159
Classification Level Classification E-value
Superfamily IpsF-like 3.92e-66
Family IpsF-like 0.00000484
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298490442|ref|YP_003720619.1|
Sequence length 162
Comment 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase ['Nostoc azollae' 0708]
Sequence
MTMNIRIGNGYDIHRLVSDRNLILGGIHIPHELGLLGHSDADVLTHAIMDAMLGALSLGD
IGHYFPPSDPQWAGADSLVLLKQVHQLIRDQGWKIGNIDSVVVAERPKLKPHIAKMRDKL
VAVLELEPNQVSVKATTNEKLGSTGREEGICAYAVVLLVASD
Download sequence
Identical sequences D7E373
WP_013190514.1.25658 gi|298490442|ref|YP_003720619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]